BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_K01 (656 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 25 2.8 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 8.5 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 8.5 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 24.6 bits (51), Expect = 2.8 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 8 APSVLXETGKASGPPVNPQTYTFFYG 85 APS + E G+++ PV+PQT YG Sbjct: 265 APSGMHEEGESALGPVSPQT-ALLYG 289 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.0 bits (47), Expect = 8.5 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = +3 Query: 450 Q*FHTFIISKPTVANNYKYKTKSYLLKVRWLKE 548 Q FH I+ + + +K + +LL + W E Sbjct: 920 QMFHNIIVFRSLFLDGFKMYARLHLLHLNWKHE 952 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.0 bits (47), Expect = 8.5 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = +3 Query: 450 Q*FHTFIISKPTVANNYKYKTKSYLLKVRWLKE 548 Q FH I+ + + +K + +LL + W E Sbjct: 921 QMFHNIIVFRSLFLDGFKMYARLHLLHLNWKHE 953 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 562,892 Number of Sequences: 2352 Number of extensions: 9185 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65232180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -