BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_J24 (476 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC11H11.01 |sst6|cps23|ESCRT I complex subunit Vps23|Schizosac... 27 1.9 SPCC74.06 |mak3|phk2|histidine kinase Mak3 |Schizosaccharomyces ... 26 2.6 SPCC1739.06c |||uroporphyrin methyltransferase |Schizosaccharomy... 26 2.6 SPBC28F2.02 |mep33||mRNA export protein Mep33|Schizosaccharomyce... 26 3.4 SPAC1142.03c |swi2|SPAC17G6.20c|Swi5 complex subunit Swi2|Schizo... 25 5.9 SPCC1450.12 |||conserved fungal protein|Schizosaccharomyces pomb... 25 7.9 >SPAC11H11.01 |sst6|cps23|ESCRT I complex subunit Vps23|Schizosaccharomyces pombe|chr 1|||Manual Length = 487 Score = 26.6 bits (56), Expect = 1.9 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +1 Query: 94 VHAFVKRDAPKEDNSLNTLAESAXKTIEELREKVESALXP 213 V A +K+D +E S L TIE+L+ K E+ P Sbjct: 128 VQALIKQDFEREHTSPPELPTKLVNTIEKLKVKEENEAPP 167 >SPCC74.06 |mak3|phk2|histidine kinase Mak3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 2344 Score = 26.2 bits (55), Expect = 2.6 Identities = 15/57 (26%), Positives = 28/57 (49%) Frame = -1 Query: 212 GXKADSTFSLNSSIVXFALSASVFRLLSSLGASRLTNACTLARQIANKIISSLFILD 42 G A + F ++ SIV A+ ++V + + A ++ NK+ S L++LD Sbjct: 410 GYMAITKFEVSQSIVYSAIVSAVAEFIRQILAEDQLLLNNFFEELKNKLESDLYLLD 466 >SPCC1739.06c |||uroporphyrin methyltransferase |Schizosaccharomyces pombe|chr 3|||Manual Length = 496 Score = 26.2 bits (55), Expect = 2.6 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = -1 Query: 182 NSSIVXFALSASVFRLLSSLGASRLTNACTLARQIANKIISSL 54 N S+ F L A+ + S +N C LA+++ ++SSL Sbjct: 121 NPSLCSFTLPATWSEPPLQISLSTSSNGCRLAQRLLRHVVSSL 163 >SPBC28F2.02 |mep33||mRNA export protein Mep33|Schizosaccharomyces pombe|chr 2|||Manual Length = 292 Score = 25.8 bits (54), Expect = 3.4 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +1 Query: 229 KLWHDGRQLQRIL*KSEARGSTESL-RSNFLVSKYITPN 342 K W DGR+ RIL ++E R S ++ RSN +Y N Sbjct: 216 KKWSDGRR-DRILKQAEERRSNRAVGRSNLSGREYFESN 253 >SPAC1142.03c |swi2|SPAC17G6.20c|Swi5 complex subunit Swi2|Schizosaccharomyces pombe|chr 1|||Manual Length = 722 Score = 25.0 bits (52), Expect = 5.9 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = +1 Query: 304 RSNFLVSKYITPNISNVIMFSTLLNKS 384 ++ L ++ TPN SNV + ++L+N+S Sbjct: 505 KNTILSNENNTPNYSNVCLSTSLINRS 531 >SPCC1450.12 |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 821 Score = 24.6 bits (51), Expect = 7.9 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 124 KEDNSLNTLAESAXKTIEELREKVESAL 207 KE NS++ L+ S KTIE R + S + Sbjct: 371 KEKNSISELSPSLQKTIEWARVNLASTI 398 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,521,885 Number of Sequences: 5004 Number of extensions: 27244 Number of successful extensions: 89 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 88 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 184476110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -