BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_J22 (652 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0628 - 25643006-25643123,25643314-25643471,25643559-256436... 90 2e-18 01_05_0142 - 18564697-18564792,18564824-18564928,18565606-185656... 33 0.20 09_02_0062 - 3742857-3743045,3744641-3744916,3745933-3745992,374... 28 5.6 06_01_1128 + 9300144-9300273,9300340-9300472,9300585-9300656,930... 27 9.8 04_01_0011 + 207319-207605,207935-208184,208559-208729 27 9.8 01_05_0078 + 17931998-17932062,17933320-17933416,17933506-179336... 27 9.8 >11_06_0628 - 25643006-25643123,25643314-25643471,25643559-25643687, 25644378-25644451,25644771-25644798 Length = 168 Score = 89.8 bits (213), Expect = 2e-18 Identities = 57/140 (40%), Positives = 74/140 (52%), Gaps = 2/140 (1%) Frame = +2 Query: 182 W*REHRADIQIEGFNPSAEEA--DEGTDSAVESGVDIVLNHRLXETYAFGDKKSYTLYLK 355 W + D+ I G NPSAE DEG D VDIV RL E F DKK + ++K Sbjct: 35 WVVQGAIDVDI-GANPSAEGGGDDEGVDDQAVKVVDIVDTFRLQEQPPF-DKKQFVTFMK 92 Query: 356 DYMKKLVXKLEXKAPDQXEVFKTNMNKVMKDILGRFKELQFFTGESMDCDGMVAMMEYXX 535 Y+K L KL+ ++ E FK N+ K +LG+ K+LQFF GESM DG + Y Sbjct: 93 RYIKNLSAKLDA---EKQEEFKKNIEGATKYLLGKLKDLQFFVGESMHDDGGLVFAYYK- 148 Query: 536 FDGTQIPIMMFFKHGLQXXK 595 DG P ++F HGL+ K Sbjct: 149 -DGATDPTFLYFSHGLKEVK 167 >01_05_0142 - 18564697-18564792,18564824-18564928,18565606-18565678, 18566262-18567637 Length = 549 Score = 33.1 bits (72), Expect = 0.20 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 4/49 (8%) Frame = -1 Query: 526 FHHGNHAITIHRLPSKEL----KFLKPAEDVFHYFVHVCFKYFXLVRRL 392 FHH H ++ PSK+L ++L+ FH F ++C++Y + R+L Sbjct: 245 FHHMLHLFQMYLKPSKKLVEGSQYLERGR-YFHSFANICYRYLKIGRKL 292 >09_02_0062 - 3742857-3743045,3744641-3744916,3745933-3745992, 3746554-3748102,3748183-3748418 Length = 769 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +2 Query: 191 EHRADIQIEGFNPSAEEADEGTDSAVESGVDIVLNHRLXETYAFGDKK 334 + + + I N S EE +E ++A VD+ LN E +G+KK Sbjct: 706 QEKFSVSINYENASLEEVEEA-EAAARYAVDVHLNRPTLELKRYGEKK 752 >06_01_1128 + 9300144-9300273,9300340-9300472,9300585-9300656, 9300783-9300926,9301453-9301524,9301584-9301677, 9301782-9301928 Length = 263 Score = 27.5 bits (58), Expect = 9.8 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +1 Query: 28 EKPFFRFLLFLIASNPS 78 E PFF FLL L++S+PS Sbjct: 2 EAPFFFFLLLLVSSSPS 18 >04_01_0011 + 207319-207605,207935-208184,208559-208729 Length = 235 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/37 (32%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = +2 Query: 266 VESGVDIVLNHRLXETYAFGDKKS-YTLYLKDYMKKL 373 + + +DIV NHRL F D++ Y+L+L +++++ Sbjct: 59 INAALDIVDNHRLDGVLYFADEEGVYSLHLFHHLRQI 95 >01_05_0078 + 17931998-17932062,17933320-17933416,17933506-17933601, 17933957-17933988,17935143-17935595,17935831-17935975, 17936058-17936159,17937798-17937890,17939448-17939489, 17940092-17940202,17940446-17940517,17940596-17940714, 17940981-17941044,17941133-17942782 Length = 1046 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -2 Query: 579 PCL-KNIMIGICVPSKXXYSIMATMPSQSIDSPV 481 PCL K+ GI P+K ++ TMPS S + + Sbjct: 200 PCLLKDASTGITKPAKEQGKLLVTMPSSSTSTKI 233 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,544,298 Number of Sequences: 37544 Number of extensions: 250003 Number of successful extensions: 550 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 540 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 546 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -