BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_J21 (605 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY600516-1|AAT11864.1| 143|Tribolium castaneum optomotor-blind-... 27 0.12 AY600515-1|AAT11863.1| 134|Tribolium castaneum optomotor-blind-... 27 0.12 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 24 0.86 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 22 4.6 >AY600516-1|AAT11864.1| 143|Tribolium castaneum optomotor-blind-like protein protein. Length = 143 Score = 27.1 bits (57), Expect = 0.12 Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 3/47 (6%) Frame = +2 Query: 2 WTFWSFSWLTFDGIDPQLMK---LNVSYPATGCQKLFEVVDEHKLRI 133 + F + W+ DP++ K ++ P+TG Q + +VV HKL++ Sbjct: 33 YKFHNSRWMVAGKADPEMPKRMYIHPDSPSTGEQWMQKVVSFHKLKL 79 >AY600515-1|AAT11863.1| 134|Tribolium castaneum optomotor-blind-like protein protein. Length = 134 Score = 27.1 bits (57), Expect = 0.12 Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 3/47 (6%) Frame = +2 Query: 2 WTFWSFSWLTFDGIDPQLMK---LNVSYPATGCQKLFEVVDEHKLRI 133 + F + W+ DP++ K ++ P+TG Q + +VV HKL++ Sbjct: 33 YKFHNSRWMVAGKADPEMPKRMYIHPDSPSTGEQWMQKVVSFHKLKL 79 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 24.2 bits (50), Expect = 0.86 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 108 TSNNFWHPVAGYETFNFMSCGSIPS 34 TS+N P+ + N MSC S+PS Sbjct: 15 TSSNAMSPMTPTYSMNSMSCVSMPS 39 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 21.8 bits (44), Expect = 4.6 Identities = 9/44 (20%), Positives = 22/44 (50%) Frame = -1 Query: 590 RCLMSGFSIFFSFLGWEHAFDDITTYIXXFAKVEQLTDFGSTFG 459 + + G ++ + + H F+ + Y A + Q+++ +TFG Sbjct: 491 KTVSDGIRHYYVNVTFPHLFNGLVDYSLWKALIFQISNLQTTFG 534 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,473 Number of Sequences: 336 Number of extensions: 2879 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15352827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -