BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_J15 (650 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_05_0081 - 18924353-18924462,18925068-18925187,18925569-189260... 31 0.60 10_07_0176 - 13826764-13827064,13827271-13827377,13827474-138278... 29 3.2 01_06_1258 + 35806557-35806932,35807517-35807679,35807789-358078... 29 3.2 08_02_1260 - 25680618-25680677,25680763-25680893,25681085-256811... 28 7.4 02_03_0360 + 18104948-18106159 28 7.4 >11_05_0081 - 18924353-18924462,18925068-18925187,18925569-18926086, 18927392-18927471,18927680-18927782,18928084-18928295, 18928392-18929210,18929331-18929444,18929935-18929983, 18930115-18930271,18930354-18930807,18930938-18931147 Length = 981 Score = 31.5 bits (68), Expect = 0.60 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +1 Query: 412 LIAVAMLSTHYYFKYLXNDWTKKGGWKVLKTKPMVL 519 +I A+L H Y+ +L DW KK W L PM L Sbjct: 578 VIVYALLIVHGYYLFLTKDWYKKTTWMYLAV-PMFL 612 >10_07_0176 - 13826764-13827064,13827271-13827377,13827474-13827836, 13827912-13828079,13828153-13828374,13828784-13829023, 13829640-13829719,13829853-13830018,13830720-13830783, 13830861-13830962,13831085-13831227,13831370-13831474, 13831551-13831706,13832125-13832241,13832315-13832392, 13832466-13832550,13833334-13833455,13833546-13833611, 13835190-13835284,13835427-13835523,13835873-13835983, 13836083-13836164,13836292-13836353,13836620-13836685, 13838002-13838232 Length = 1142 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = -2 Query: 133 LFVPFFRIIATLGSREKNA*FVLIKIRSSFFFFVNL 26 +F+ + I T R++N FV+ + S+FFF++ L Sbjct: 992 MFIFIYSAIMTSFDRQENVYFVIYVLMSTFFFYLTL 1027 >01_06_1258 + 35806557-35806932,35807517-35807679,35807789-35807837, 35807943-35808866,35808954-35809049,35809142-35809257, 35809345-35809447,35809570-35809658,35809750-35809900, 35809995-35810141,35810238-35810366,35810451-35810529, 35810616-35810725 Length = 843 Score = 29.1 bits (62), Expect = 3.2 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 Query: 412 LIAVAMLSTHYYFKYLXNDWTKKGGWKVL 498 ++A +L H YF +L +W KK W L Sbjct: 481 VLAYVLLVVHSYFIFLTREWYKKTTWMYL 509 >08_02_1260 - 25680618-25680677,25680763-25680893,25681085-25681163, 25681250-25681280,25681358-25681410,25681441-25681511, 25681610-25681678,25681776-25681889,25683101-25683293 Length = 266 Score = 27.9 bits (59), Expect = 7.4 Identities = 20/81 (24%), Positives = 36/81 (44%), Gaps = 1/81 (1%) Frame = +1 Query: 157 VGRVASERERCLGMTDAERAWRKQWLKDQVLAAHEPVHVEXYWXERTNPIRRFYRK-PLD 333 V R+ ++ + +T + ++R + LKD L + +HV W P + PLD Sbjct: 165 VNRILKDKGVYILITYGDPSYRLRLLKDLQLWTVK-LHVIDRWERSREPSWELTKPLPLD 223 Query: 334 VLFAKLTPMLGEQRAAHYXYI 396 + +LG + HY Y+ Sbjct: 224 GDSTSIVSLLGPKPDVHYIYV 244 >02_03_0360 + 18104948-18106159 Length = 403 Score = 27.9 bits (59), Expect = 7.4 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +1 Query: 172 SERERCLGMTDAERAWRKQWLKDQVLAAHEPVHVEXYWXE 291 SER + L DAER + L++Q+LA H V V W + Sbjct: 363 SERSKDLDEEDAERYEAIKNLREQMLAGHGFVLVSQEWGQ 402 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,494,292 Number of Sequences: 37544 Number of extensions: 328175 Number of successful extensions: 729 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 713 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 729 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -