BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_J15 (650 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45117| Best HMM Match : Band_41 (HMM E-Value=7.4e-26) 28 5.7 SB_8470| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 >SB_45117| Best HMM Match : Band_41 (HMM E-Value=7.4e-26) Length = 458 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 5 GYFLLPVQVDKEKKRRPYFYQNKLGIFFSRTKCSYY 112 G FL PV +D++ YF Q KLG + S+ Y Sbjct: 178 GKFLKPVSIDQQAVLDSYFAQLKLGDYDSKKNSKGY 213 >SB_8470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3133 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +3 Query: 303 YSSFLPETLGRTLCETYPNAGRTTCCTLXIYIWKTWFNRC 422 + S + + R L E P G+TT C + W RC Sbjct: 978 FKSKTKKRMKRVLLEGNPGVGKTTLCKKLVNSWALGVQRC 1017 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,768,798 Number of Sequences: 59808 Number of extensions: 407371 Number of successful extensions: 857 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 815 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 857 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -