BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_J15 (650 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g71070.1 68414.m08202 glycosyltransferase family 14 protein /... 30 1.2 At5g51060.1 68418.m06329 respiratory burst oxidase protein C (Rb... 29 2.0 At1g09090.2 68414.m01015 respiratory burst oxidase protein B (Rb... 29 2.7 At1g09090.1 68414.m01014 respiratory burst oxidase protein B (Rb... 29 2.7 At1g32550.1 68414.m04017 ferredoxin family protein similar to fe... 29 3.5 At4g25090.1 68417.m03604 respiratory burst oxidase, putative / N... 28 6.2 At3g53320.1 68416.m05883 expressed protein 27 8.2 At3g50740.1 68416.m05552 UDP-glucoronosyl/UDP-glucosyl transfera... 27 8.2 >At1g71070.1 68414.m08202 glycosyltransferase family 14 protein / core-2/I-branching enzyme family protein similar to glucosaminyl (N-acetyl) transferase GB:4758422 from [Homo sapiens] Length = 395 Score = 30.3 bits (65), Expect = 1.2 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 4/57 (7%) Frame = +2 Query: 305 FVVFTGNPWTYSLRN-LPQC---WENNVLHIIXIYLENLV*SLWLCYQHITTLNIXE 463 F VFTG+PW R L C W+ N+ I+ +Y N++ S CY H N E Sbjct: 220 FKVFTGSPWIVLSRPFLEYCIFGWD-NLPRILLMYFNNVILS-EECYFHTVICNAPE 274 >At5g51060.1 68418.m06329 respiratory burst oxidase protein C (RbohC) / NADPH oxidase nearly identical to respiratory burst oxidase protein C from Arabidopsis thaliana [gi:3242785] Length = 905 Score = 29.5 bits (63), Expect = 2.0 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +1 Query: 406 LGLIAVAMLSTHYYFKYLXNDWTKKGGWKVLKTKPMVL 519 L +I +L H Y+ YL DW K W L P+VL Sbjct: 540 LFVIVYILLVAHGYYLYLTRDWHNKTTWMYL-VVPVVL 576 >At1g09090.2 68414.m01015 respiratory burst oxidase protein B (RbohB) / NADPH oxidase identical to respiratory burst oxidase protein B from Arabidopsis thaliana [gi:3242783] Length = 843 Score = 29.1 bits (62), Expect = 2.7 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +1 Query: 391 YISGKLGLIAVAMLSTHYYFKYLXNDWTKKGGWKVLKTKPMVL 519 + S L +I +L H YF YL +W K W L P++L Sbjct: 481 WYSHHLFVIVYVLLIVHGYFVYLSKEWYHKTTWMYLAV-PVLL 522 >At1g09090.1 68414.m01014 respiratory burst oxidase protein B (RbohB) / NADPH oxidase identical to respiratory burst oxidase protein B from Arabidopsis thaliana [gi:3242783] Length = 622 Score = 29.1 bits (62), Expect = 2.7 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +1 Query: 391 YISGKLGLIAVAMLSTHYYFKYLXNDWTKKGGWKVLKTKPMVL 519 + S L +I +L H YF YL +W K W L P++L Sbjct: 481 WYSHHLFVIVYVLLIVHGYFVYLSKEWYHKTTWMYLAV-PVLL 522 >At1g32550.1 68414.m04017 ferredoxin family protein similar to ferredoxin from Synechocystis sp. [GI:48019]; contains Pfam profile PF00111 2Fe-2S iron-sulfur cluster binding domain Length = 181 Score = 28.7 bits (61), Expect = 3.5 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -3 Query: 228 LLTPSPFCISHTKTSFPFT-GYATNYRHRFNTRCLCHF 118 L+ P FC S K +FP Y TN+R R T C F Sbjct: 3 LILPCTFCTSLQKKNFPINRRYITNFR-RGATTATCEF 39 >At4g25090.1 68417.m03604 respiratory burst oxidase, putative / NADPH oxidase, putative similar to respiratory burst oxidase protein A from Arabidopsis thaliana, gb:AF055353 [gi:3242781], protein D [gi:3242789]; contains Pfam profile PF01794 Ferric reductase like transmembrane component Length = 849 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +1 Query: 406 LGLIAVAMLSTHYYFKYLXNDWTKKGGWKVL 498 L +I +L H Y+ YL +W KK W L Sbjct: 493 LFVIVYILLVLHGYYIYLNKEWYKKTTWMYL 523 >At3g53320.1 68416.m05883 expressed protein Length = 553 Score = 27.5 bits (58), Expect = 8.2 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +1 Query: 499 KTKPMVLPGQPGFPFKSXKTDSDYAERKFXSS 594 + KP VLP +PG PFKS SD ++ + SS Sbjct: 294 RAKP-VLP-KPGVPFKSSSRSSDASKNEMTSS 323 >At3g50740.1 68416.m05552 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 487 Score = 27.5 bits (58), Expect = 8.2 Identities = 18/66 (27%), Positives = 32/66 (48%) Frame = +1 Query: 328 LDVLFAKLTPMLGEQRAAHYXYISGKLGLIAVAMLSTHYYFKYLXNDWTKKGGWKVLKTK 507 +D+ P+ GE Y +I+ +AVA+ +F L D ++ ++K + Sbjct: 115 VDLFGLDAIPLGGEFNMLTYIFIASNARFLAVAL-----FFPTLDKDMEEE---HIIKKQ 166 Query: 508 PMVLPG 525 PMV+PG Sbjct: 167 PMVMPG 172 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,952,500 Number of Sequences: 28952 Number of extensions: 286638 Number of successful extensions: 689 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 669 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 689 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -