BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_J10 (653 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0116 + 31773295-31773603,31773800-31773946,31774080-317741... 29 3.2 02_04_0543 + 23766089-23766328,23766976-23767212,23767601-23767876 28 7.5 01_05_0735 - 24749975-24750601,24751411-24751541,24752150-247523... 28 7.5 11_03_0142 + 10675764-10675991,10676533-10676943 27 9.9 02_05_0118 - 25991356-25991686,25991797-25992092,25992405-259931... 27 9.9 02_05_0113 - 25941189-25941519,25941630-25941925,25942238-259429... 27 9.9 >03_06_0116 + 31773295-31773603,31773800-31773946,31774080-31774158, 31777558-31778180 Length = 385 Score = 29.1 bits (62), Expect = 3.2 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +3 Query: 378 AFSQRLTKAPGPKLGMVALQSLWRLYNNLQPNSPLRYHVY 497 AFS+R K PK + L W L+ + P +R H+Y Sbjct: 227 AFSKRTKKGKLPKEARLKLLHWWELHYDKWPYPSVRTHIY 266 >02_04_0543 + 23766089-23766328,23766976-23767212,23767601-23767876 Length = 250 Score = 27.9 bits (59), Expect = 7.5 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 270 DACFKEPSESDIEAILNSIVSIMVSIPLXRGENL 371 D FKE + ++ IL ++ I+V I + RGE L Sbjct: 136 DESFKESLDELVQVILATVAFILVYIHIIRGEEL 169 >01_05_0735 - 24749975-24750601,24751411-24751541,24752150-24752336, 24753801-24753898,24754182-24754689 Length = 516 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/41 (29%), Positives = 25/41 (60%) Frame = +3 Query: 423 MVALQSLWRLYNNLQPNSPLRYHVYYHVIXLAARVGFVREV 545 ++A L +Y +L PN PL+ +Y+ +I +A + F+ ++ Sbjct: 195 LLAADCLEIMYTSLSPNGPLK--LYHFIIIVAVALAFLSQL 233 >11_03_0142 + 10675764-10675991,10676533-10676943 Length = 212 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -3 Query: 141 INTAGPCILIPFLNCILLFIIYKH*SECKN 52 + + GP + +P +NC LL ++ K C N Sbjct: 147 VGSLGPMVAVPCVNCHLLVMLCKSSPACPN 176 >02_05_0118 - 25991356-25991686,25991797-25992092,25992405-25993109, 25993197-25993298,25993519-25993846,25994337-25994461, 25994555-25994628,25995110-25995191,25995278-25995391, 25995475-25995575,25995663-25995752,25996316-25996562 Length = 864 Score = 27.5 bits (58), Expect = 9.9 Identities = 13/50 (26%), Positives = 22/50 (44%) Frame = -2 Query: 322 LFRMASMSDSLGSLKQASQTPTILCRSSSMPLGDFXSEISAPRLVKISSQ 173 L R SMS + + K A ++ C + +G+F +E+ V Q Sbjct: 603 LSRAGSMSSEISTFKDAKTNGSVACDTEFTGIGEFVAELKEMAQVHYQKQ 652 >02_05_0113 - 25941189-25941519,25941630-25941925,25942238-25942942, 25943030-25943131,25943352-25943679,25944170-25944294, 25944388-25944453,25945046-25945109,25945739-25945821, 25945917-25945943 Length = 708 Score = 27.5 bits (58), Expect = 9.9 Identities = 13/50 (26%), Positives = 22/50 (44%) Frame = -2 Query: 322 LFRMASMSDSLGSLKQASQTPTILCRSSSMPLGDFXSEISAPRLVKISSQ 173 L R SMS + + K A ++ C + +G+F +E+ V Q Sbjct: 447 LSRAGSMSSEISTFKDAKTNGSVACDTEFTGIGEFVAELKEMAQVHYQKQ 496 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,333,157 Number of Sequences: 37544 Number of extensions: 273498 Number of successful extensions: 603 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 596 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 603 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1632177336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -