BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_J10 (653 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 22 6.0 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 22 6.0 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 7.9 AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc fi... 21 7.9 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.8 bits (44), Expect = 6.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 137 FMDISLEDQALELRRYFNE 193 F + LEDQ L LR +NE Sbjct: 255 FTSLPLEDQVLLLRAGWNE 273 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.8 bits (44), Expect = 6.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 137 FMDISLEDQALELRRYFNE 193 F + LEDQ L LR +NE Sbjct: 255 FTSLPLEDQVLLLRAGWNE 273 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.4 bits (43), Expect = 7.9 Identities = 16/63 (25%), Positives = 25/63 (39%) Frame = -1 Query: 422 SKFRARSLSEPLTKC*DKVFSSX*WYRNHNRDNTVQNGFDVRFTRLFETSITNPNDLMQI 243 SK R+R +E K+ SS HN +N N ++ + + N L Sbjct: 296 SKERSRDRTERERSREPKIISSLSNKTIHNNNNYNNNNYNNNYNNYNNNNYNNYKKLYYN 355 Query: 242 ILN 234 I+N Sbjct: 356 IIN 358 >AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc finger domain-Z1 isoform protein. Length = 111 Score = 21.4 bits (43), Expect = 7.9 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = -1 Query: 440 RLQSYHSKFRARSLSEPLTKC*DKVFSSX*WYRNH 336 RL+ + R EP+ +V+SS RNH Sbjct: 17 RLRRHIQNVHTRPSKEPICNICKRVYSSLNSLRNH 51 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,112 Number of Sequences: 438 Number of extensions: 2944 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -