BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_J05 (654 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 24 1.5 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 2.6 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/37 (29%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +1 Query: 370 WIHNHN-GQTTELLSCSVDKTAVIWTLQNGCWNVTSI 477 W N N T + ++D+ +W L NG TS+ Sbjct: 113 WAKNQNCSGITSVYRIAIDEWDRLWVLDNGISGETSV 149 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.0 bits (47), Expect = 2.6 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = -1 Query: 402 LCCLAIMIVYPFYRVYVSCMVTQYCYSIFSFFIRITNN 289 LC L+ M+ P Y +Y+ + F IRI +N Sbjct: 587 LCGLSSMLCIPGYMIYIWFTTSGTISEKFRKLIRIEDN 624 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,100 Number of Sequences: 438 Number of extensions: 3184 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -