BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_J02 (392 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g60245.1 68416.m06733 60S ribosomal protein L37a (RPL37aC) 131 2e-31 At3g10950.1 68416.m01320 60S ribosomal protein L37a (RPL37aB) si... 124 2e-29 At4g28730.1 68417.m04109 glutaredoxin family protein contains gl... 27 3.4 At4g38600.2 68417.m05463 HECT-domain-containing protein / ubiqui... 27 6.0 At4g38600.1 68417.m05464 HECT-domain-containing protein / ubiqui... 27 6.0 At1g58520.1 68414.m06653 early-responsive to dehydration protein... 27 6.0 >At3g60245.1 68416.m06733 60S ribosomal protein L37a (RPL37aC) Length = 92 Score = 131 bits (316), Expect = 2e-31 Identities = 57/88 (64%), Positives = 68/88 (77%) Frame = +3 Query: 45 MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 224 MAKRTKKVGI GKYGTRYGAS+RK +KKMEV+QH+KY C FCGK +KR VGIW CK C Sbjct: 1 MAKRTKKVGIVGKYGTRYGASIRKQIKKMEVSQHSKYFCEFCGKYGVKRKAVGIWGCKDC 60 Query: 225 KRTVXGGAWVFSTTAASSCRSAVRRLRE 308 + GGA+ +T +A + RS +RRLRE Sbjct: 61 GKVKAGGAYTMNTASAVTVRSTIRRLRE 88 >At3g10950.1 68416.m01320 60S ribosomal protein L37a (RPL37aB) similar to putative 60S ribosomal protein L37a GB:AAD28753 [Gossypium hirsutum] Length = 92 Score = 124 bits (299), Expect = 2e-29 Identities = 55/88 (62%), Positives = 65/88 (73%) Frame = +3 Query: 45 MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 224 M KRTKK I GKYGTRYGASLRK +KKMEV+QH KY C FCGK ++KR VGIW CK C Sbjct: 1 MTKRTKKARIVGKYGTRYGASLRKQIKKMEVSQHNKYFCEFCGKYSVKRKVVGIWGCKDC 60 Query: 225 KRTVXGGAWVFSTTAASSCRSAVRRLRE 308 + GGA+ +T +A + RS +RRLRE Sbjct: 61 GKVKAGGAYTMNTASAVTVRSTIRRLRE 88 >At4g28730.1 68417.m04109 glutaredoxin family protein contains glutaredoxin domain, Pfam:PF00462 Length = 174 Score = 27.5 bits (58), Expect = 3.4 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +3 Query: 75 TGKYGTRYGASLRKMVKKMEVTQHAKYTCSFC 170 + +G+R S+RK V + V ++K CS+C Sbjct: 62 SSSFGSRMEESIRKTVTENTVVIYSKTWCSYC 93 >At4g38600.2 68417.m05463 HECT-domain-containing protein / ubiquitin-transferase family protein similar to SP|Q14669Thyroid receptor interacting protein 12 (TRIP12) {Homo sapiens}; contains Pfam profile PF00632: HECT-domain (ubiquitin-transferase) Length = 1794 Score = 26.6 bits (56), Expect = 6.0 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -2 Query: 250 QAPPXTVLLHRLQDQMPTQERF 185 + PP TVL+ +LQ+ + + ERF Sbjct: 802 KVPPMTVLIQKLQNALSSLERF 823 >At4g38600.1 68417.m05464 HECT-domain-containing protein / ubiquitin-transferase family protein similar to SP|Q14669Thyroid receptor interacting protein 12 (TRIP12) {Homo sapiens}; contains Pfam profile PF00632: HECT-domain (ubiquitin-transferase) Length = 1888 Score = 26.6 bits (56), Expect = 6.0 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -2 Query: 250 QAPPXTVLLHRLQDQMPTQERF 185 + PP TVL+ +LQ+ + + ERF Sbjct: 875 KVPPMTVLIQKLQNALSSLERF 896 >At1g58520.1 68414.m06653 early-responsive to dehydration protein-related / ERD protein-related low similarity to ERD4 protein (early-responsive to dehydration stress) [Arabidopsis thaliana] GI:15375406; contains Pfam profile PF02714: Domain of unknown function DUF221 Length = 657 Score = 26.6 bits (56), Expect = 6.0 Identities = 13/36 (36%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +2 Query: 5 FLCQLLYXERFTNNGQT-YQKGWNYWQIWHTLRCLS 109 FL L+Y + N T Y+ G YW I+H S Sbjct: 485 FLAYLIYKNQILNVYITKYESGGQYWPIFHNTTIFS 520 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,494,666 Number of Sequences: 28952 Number of extensions: 149351 Number of successful extensions: 427 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 424 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 427 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 567552648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -