BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_I22 (513 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1648| Best HMM Match : UPF0061 (HMM E-Value=5.2e-10) 27 6.9 SB_49173| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_14030| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_13875| Best HMM Match : rve (HMM E-Value=4.5e-15) 27 9.1 >SB_1648| Best HMM Match : UPF0061 (HMM E-Value=5.2e-10) Length = 371 Score = 27.5 bits (58), Expect = 6.9 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +3 Query: 237 PSAGAEDQGHRYKGPREWLGRAVDHPRRIGL*LRQHQTEXR*RIRL 374 P A A ++ + K R+WLGR + R G H T+ + RIR+ Sbjct: 262 PGAWALEEAQQQKNWRDWLGRYQERLGRNG----GHDTDEKRRIRM 303 >SB_49173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.1 bits (57), Expect = 9.1 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -2 Query: 335 KLKPNPPRVIDGSAKPFSRSFIAMPLIFCSG*G 237 K KPNP +D S P+ R +A CS G Sbjct: 35 KAKPNPIPPVDSSGGPYYRGAVAADAKNCSAIG 67 >SB_14030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 765 Score = 27.1 bits (57), Expect = 9.1 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -2 Query: 335 KLKPNPPRVIDGSAKPFSRSFIAMPLIFCSG*G 237 K KPNP +D S P+ R +A CS G Sbjct: 195 KAKPNPIPPVDSSGGPYYRGAVAADAKNCSAIG 227 >SB_13875| Best HMM Match : rve (HMM E-Value=4.5e-15) Length = 1216 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -2 Query: 305 DGSAKPFSRSFIAMPLI 255 DGSAKP +RSF++ P + Sbjct: 521 DGSAKPATRSFVSSPYL 537 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,493,140 Number of Sequences: 59808 Number of extensions: 275378 Number of successful extensions: 566 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 542 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 564 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1136110413 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -