BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_I22 (513 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-3573|AAM68241.1| 122|Drosophila melanogaster CG30413-P... 33 0.17 AE013599-2754|ABC66050.1| 119|Drosophila melanogaster CG33998-P... 32 0.52 BT023029-1|AAY55445.1| 112|Drosophila melanogaster IP04046p pro... 30 2.1 AE013599-1628|AAF58431.1| 112|Drosophila melanogaster CG13324-P... 30 2.1 AE013599-1627|AAF58432.1| 112|Drosophila melanogaster CG13323-P... 30 2.1 BT022529-1|AAY54945.1| 255|Drosophila melanogaster IP06473p pro... 29 4.9 AE014296-2036|AAF50005.2| 255|Drosophila melanogaster CG14130-P... 29 4.9 AE014298-1339|ABC67180.1| 117|Drosophila melanogaster CG34026-P... 28 8.5 >AE013599-3573|AAM68241.1| 122|Drosophila melanogaster CG30413-PA protein. Length = 122 Score = 33.5 bits (73), Expect = 0.17 Identities = 20/47 (42%), Positives = 25/47 (53%) Frame = +1 Query: 256 IKGIAIKDLENGLAEPSITRGGLGFNFVNIKLXSDRGSGFKFVIEIY 396 IK +K + AE IT GG+G V IK S RG+G K + IY Sbjct: 75 IKITDLKKMRGATAE--ITSGGVGSTTVTIKFTSARGAGIKSQVVIY 119 >AE013599-2754|ABC66050.1| 119|Drosophila melanogaster CG33998-PA protein. Length = 119 Score = 31.9 bits (69), Expect = 0.52 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = +1 Query: 271 IKDLENGLAEPSITRGGLGFNFVNIKLXSDRGSGFKFVIEIY 396 I+D G A +T GG + I L S R GF F+I+IY Sbjct: 78 IRDGNGGYAY--LTAGGPQTTYAKIHLKSQRNQGFSFIIDIY 117 >BT023029-1|AAY55445.1| 112|Drosophila melanogaster IP04046p protein. Length = 112 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/68 (25%), Positives = 26/68 (38%), Gaps = 2/68 (2%) Frame = +1 Query: 199 PLFKRVQEVFFEFPQPEQKIKGIAIKD--LENGLAEPSITRGGLGFNFVNIKLXSDRGSG 372 P+ V +P I + + D N A PS+ GG G+ F + L G Sbjct: 43 PIKNNYWNVNVNYPAGFYNISAVIVYDNFKNNSGASPSLYSGGPGYRFATVNLRGQVNRG 102 Query: 373 FKFVIEIY 396 +EI+ Sbjct: 103 INSTVEIW 110 >AE013599-1628|AAF58431.1| 112|Drosophila melanogaster CG13324-PA protein. Length = 112 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/68 (25%), Positives = 26/68 (38%), Gaps = 2/68 (2%) Frame = +1 Query: 199 PLFKRVQEVFFEFPQPEQKIKGIAIKD--LENGLAEPSITRGGLGFNFVNIKLXSDRGSG 372 P+ V +P I + + D N A PS+ GG G+ F + L G Sbjct: 43 PIKNNYWNVNVNYPNGFYNISAVIVYDNFKNNSGASPSLYSGGPGYRFATVNLRGQVNRG 102 Query: 373 FKFVIEIY 396 +EI+ Sbjct: 103 IDSTVEIW 110 >AE013599-1627|AAF58432.1| 112|Drosophila melanogaster CG13323-PA protein. Length = 112 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/68 (25%), Positives = 26/68 (38%), Gaps = 2/68 (2%) Frame = +1 Query: 199 PLFKRVQEVFFEFPQPEQKIKGIAIKD--LENGLAEPSITRGGLGFNFVNIKLXSDRGSG 372 P+ V +P I + + D N A PS+ GG G+ F + L G Sbjct: 43 PIKNNYWNVNVNYPAGFYNISAVIVYDNFKNNSGASPSLYSGGPGYRFATVNLRGQVNRG 102 Query: 373 FKFVIEIY 396 +EI+ Sbjct: 103 INSTVEIW 110 >BT022529-1|AAY54945.1| 255|Drosophila melanogaster IP06473p protein. Length = 255 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/51 (29%), Positives = 31/51 (60%) Frame = +1 Query: 151 NVVRKVHEQSVEANAIPLFKRVQEVFFEFPQPEQKIKGIAIKDLENGLAEP 303 +++R+ H Q+VE+NAI + F ++P+ EQK ++ + + ++EP Sbjct: 12 HILRRCHRQAVESNAIK--ANLTAYFGKWPETEQKEFRQHMRIITDFISEP 60 >AE014296-2036|AAF50005.2| 255|Drosophila melanogaster CG14130-PA protein. Length = 255 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/51 (29%), Positives = 31/51 (60%) Frame = +1 Query: 151 NVVRKVHEQSVEANAIPLFKRVQEVFFEFPQPEQKIKGIAIKDLENGLAEP 303 +++R+ H Q+VE+NAI + F ++P+ EQK ++ + + ++EP Sbjct: 12 HILRRCHRQAVESNAIK--ANLTAYFGKWPETEQKEFRQHMRIITDFISEP 60 >AE014298-1339|ABC67180.1| 117|Drosophila melanogaster CG34026-PA protein. Length = 117 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 307 ITRGGLGFNFVNIKLXSDRGSGFKFVIEIY 396 + GG G IK S+RG G K ++EI+ Sbjct: 86 LVSGGPGSKGATIKFTSERGYGIKDIVEIW 115 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,047,765 Number of Sequences: 53049 Number of extensions: 416123 Number of successful extensions: 898 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 874 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 898 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1867000320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -