BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_I21 (623 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z79755-7|CAB02103.1| 466|Caenorhabditis elegans Hypothetical pr... 55 4e-08 Z93377-11|CAM84803.1| 332|Caenorhabditis elegans Hypothetical p... 29 3.6 Z81513-15|CAM84808.1| 332|Caenorhabditis elegans Hypothetical p... 29 3.6 AC084197-15|AAN63425.1| 391|Caenorhabditis elegans Hypothetical... 28 4.7 AC084197-14|AAM44396.1| 526|Caenorhabditis elegans Hypothetical... 28 4.7 AC084197-13|AAM44395.1| 571|Caenorhabditis elegans Hypothetical... 28 4.7 U55369-8|AAK52178.1| 84|Caenorhabditis elegans Hypothetical pr... 27 8.2 >Z79755-7|CAB02103.1| 466|Caenorhabditis elegans Hypothetical protein F43G9.10 protein. Length = 466 Score = 55.2 bits (127), Expect = 4e-08 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +2 Query: 215 TAGAIPIRNEKGEISMQKVKVQRYISGKKPDYAQ 316 T GAIPI+NEKG+ MQKVKV RY++GK P+YA+ Sbjct: 25 TLGAIPIKNEKGQTVMQKVKVSRYVAGKAPEYAR 58 >Z93377-11|CAM84803.1| 332|Caenorhabditis elegans Hypothetical protein F13A7.14 protein. Length = 332 Score = 28.7 bits (61), Expect = 3.6 Identities = 10/25 (40%), Positives = 20/25 (80%) Frame = +3 Query: 195 NLQAFRVQREQFR*EMKKVRSRCKR 269 +++ R +R+QF+ EM+K RS+C++ Sbjct: 151 DVEKLRRERDQFKKEMEKYRSKCEK 175 >Z81513-15|CAM84808.1| 332|Caenorhabditis elegans Hypothetical protein F13A7.14 protein. Length = 332 Score = 28.7 bits (61), Expect = 3.6 Identities = 10/25 (40%), Positives = 20/25 (80%) Frame = +3 Query: 195 NLQAFRVQREQFR*EMKKVRSRCKR 269 +++ R +R+QF+ EM+K RS+C++ Sbjct: 151 DVEKLRRERDQFKKEMEKYRSKCEK 175 >AC084197-15|AAN63425.1| 391|Caenorhabditis elegans Hypothetical protein Y73B6BL.5c protein. Length = 391 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 365 QRPERKQVLPQIITRKEXHHSDSEKEVD 448 +RPE Q HHSDSE+E+D Sbjct: 120 ERPESHQSAHSAAVSNASHHSDSEEELD 147 >AC084197-14|AAM44396.1| 526|Caenorhabditis elegans Hypothetical protein Y73B6BL.5b protein. Length = 526 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 365 QRPERKQVLPQIITRKEXHHSDSEKEVD 448 +RPE Q HHSDSE+E+D Sbjct: 255 ERPESHQSAHSAAVSNASHHSDSEEELD 282 >AC084197-13|AAM44395.1| 571|Caenorhabditis elegans Hypothetical protein Y73B6BL.5a protein. Length = 571 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 365 QRPERKQVLPQIITRKEXHHSDSEKEVD 448 +RPE Q HHSDSE+E+D Sbjct: 300 ERPESHQSAHSAAVSNASHHSDSEEELD 327 >U55369-8|AAK52178.1| 84|Caenorhabditis elegans Hypothetical protein C18C4.6 protein. Length = 84 Score = 27.5 bits (58), Expect = 8.2 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 291 LEKSLTMHKECHHLRNQMXKILXSNKD 371 LE+ LT + C+H NQ K+L ++ D Sbjct: 44 LEQELTQAQICNHRLNQQLKVLANSSD 70 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,568,050 Number of Sequences: 27780 Number of extensions: 220346 Number of successful extensions: 592 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 575 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 592 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1363963182 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -