BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_I18 (654 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37277| Best HMM Match : Oxysterol_BP (HMM E-Value=0) 51 9e-07 SB_48172| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_37867| Best HMM Match : PH (HMM E-Value=0.0027) 33 0.20 SB_321| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.47 SB_50149| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_10793| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_21872| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_42880| Best HMM Match : Laminin_II (HMM E-Value=2.1) 28 7.6 SB_10947| Best HMM Match : PH (HMM E-Value=1.3e-11) 28 7.6 >SB_37277| Best HMM Match : Oxysterol_BP (HMM E-Value=0) Length = 926 Score = 50.8 bits (116), Expect = 9e-07 Identities = 36/107 (33%), Positives = 48/107 (44%) Frame = +1 Query: 100 KMMKTGLTSHRPLSGQLYKYTNVVKGWQQRWFAVDPETGVLSYYLYDGPXDTIQPGQPAR 279 K M G G L K+TN +KG+Q+RWF + G+LSYY + + R Sbjct: 304 KNMPDGRVCPDHFRGWLLKWTNYIKGYQRRWFVL--SNGLLSYY-----RNQAEMAHTCR 356 Query: 280 GEAHLXAAVICPXDEXSKTFTINCAXGDMLXLRATDARARQEWVDGL 420 G +L A I D S F I+ + LRA+ RQ WV L Sbjct: 357 GTINLAGAFIDTEDACS--FVISNGGTQVFHLRASTEVERQRWVTAL 401 >SB_48172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 547 Score = 33.5 bits (73), Expect = 0.15 Identities = 24/88 (27%), Positives = 37/88 (42%), Gaps = 7/88 (7%) Frame = +1 Query: 178 WQQRWFAVDPETGVLSYYLYDG------PXDTIQPGQPARGEAHLXAAVICPXDEXSKTF 339 WQ+RW + E G+LSY+LY G P ++ Q A + V+C + Sbjct: 279 WQRRWCVL--EGGMLSYWLYPGDETTKAPLGSLDLSQCASSHVTTVSRVLCARPNTMELV 336 Query: 340 TINCAXGDMLXLRATDARA-RQEWVDGL 420 + L A D +A + W+D L Sbjct: 337 INKGDNNSIKYLLAADTKADKVTWLDSL 364 >SB_37867| Best HMM Match : PH (HMM E-Value=0.0027) Length = 369 Score = 33.1 bits (72), Expect = 0.20 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +1 Query: 142 GQLYKYTNVVKGWQQRWFAVDPETGVLSYY 231 G L+K ++ K W+ RWF +D + L YY Sbjct: 214 GYLHKRGHLFKQWKSRWFVLDTQRNQLRYY 243 >SB_321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 496 Score = 31.9 bits (69), Expect = 0.47 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +1 Query: 178 WQQRWFAVDPETGVLSYYLYD 240 WQ+RWF ++ GVL Y++YD Sbjct: 20 WQRRWFVLN-SAGVLEYFIYD 39 >SB_50149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 656 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +1 Query: 460 NPPLQPR-EQLAVHDAMASARQQLQATELSDAALARCIESSDSPFPHTDPD 609 NP L+ R E++A+ M++ ++ L +D C + SDS TDP+ Sbjct: 590 NPLLEHRTEKVALSKPMSNGKEDLNTETTADVNKKSCADGSDSIIGTTDPN 640 >SB_10793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/44 (31%), Positives = 20/44 (45%), Gaps = 6/44 (13%) Frame = -3 Query: 556 GPRH*VRSLVAAAWPTPWRR------GPRAALSAAGAGWPPSPW 443 GPR+ ++ PTPW + GPR + G P+PW Sbjct: 305 GPRYTSNTMDQGTHPTPWTKVHIQHYGPRYTSNTMDQGTHPTPW 348 Score = 28.3 bits (60), Expect = 5.8 Identities = 14/44 (31%), Positives = 20/44 (45%), Gaps = 6/44 (13%) Frame = -3 Query: 556 GPRH*VRSLVAAAWPTPWRR------GPRAALSAAGAGWPPSPW 443 GPR+ ++ PTPW + GPR + G P+PW Sbjct: 279 GPRYTSNNMDQRTHPTPWTKVHIKHHGPRYTSNTMDQGTHPTPW 322 >SB_21872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 575 Score = 28.3 bits (60), Expect = 5.8 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +1 Query: 160 TNVVKGWQQRWFAVDPETGVLSYYLY 237 TN+V + W+ DP TG L Y + Sbjct: 492 TNIVTSVDKSWYPTDPNTGHLENYFF 517 >SB_42880| Best HMM Match : Laminin_II (HMM E-Value=2.1) Length = 647 Score = 27.9 bits (59), Expect = 7.6 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = +1 Query: 391 RARQEWVDGLRAIAXIHTKV 450 +AR +WV+ LRAI+ H+K+ Sbjct: 456 KARSQWVNALRAISSRHSKL 475 >SB_10947| Best HMM Match : PH (HMM E-Value=1.3e-11) Length = 591 Score = 27.9 bits (59), Expect = 7.6 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +1 Query: 160 TNVVKGWQQRWFAVDPETGVLSYY 231 T V K W++RWF +D L+Y+ Sbjct: 495 TEVRKNWKKRWFVLDFTKKYLAYF 518 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,009,414 Number of Sequences: 59808 Number of extensions: 339436 Number of successful extensions: 887 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 843 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 883 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -