BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_I15 (650 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 23 3.4 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 23 3.4 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 22 4.5 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 Query: 600 LYXLXKYGKHQLKYI 556 L+ L KYGK+Q+K + Sbjct: 234 LFNLTKYGKNQIKLL 248 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 22.6 bits (46), Expect = 3.4 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = -1 Query: 218 LTWASICLTIWSMVCVSSMRAMF--LSSITYRKRCF 117 +T+ IC I M VS + AM+ ++T R R + Sbjct: 431 VTFTEICSRITPMEVVSMLNAMYSLFDTLTERNRVY 466 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 Query: 360 IVFPRGLTRGPTTGHARVLYDNAAD 286 I FPR +TR T ++ DN A+ Sbjct: 584 IEFPRSITRNATALIKKLCRDNPAE 608 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,953 Number of Sequences: 438 Number of extensions: 3673 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -