BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_I09 (425 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor... 24 2.6 U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase... 23 3.4 U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase... 23 3.4 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 23 3.4 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 23 4.5 AY752907-1|AAV30081.1| 97|Anopheles gambiae peroxidase 13A pro... 22 7.9 >DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor 24 protein. Length = 378 Score = 23.8 bits (49), Expect = 2.6 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -2 Query: 160 DVAIHTCLAFVFLCWSYLDSFVITTPIF 77 D TC F F+C YL F+IT I+ Sbjct: 223 DTGFSTCYTFTFIC-LYL-FFIITLSIY 248 >U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase protein. Length = 260 Score = 23.4 bits (48), Expect = 3.4 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +2 Query: 35 IIPLPSCSQDVQPLENRCSNDK 100 ++P P+ S D+ P+EN S K Sbjct: 185 VLPWPALSPDLNPIENLWSTLK 206 >U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase protein. Length = 332 Score = 23.4 bits (48), Expect = 3.4 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +2 Query: 35 IIPLPSCSQDVQPLENRCSNDK 100 ++P P+ S D+ P+EN S K Sbjct: 257 VLPWPALSPDLNPIENLWSTLK 278 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 23.4 bits (48), Expect = 3.4 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +2 Query: 83 RCSNDKAIQVAPAQEHKGKASVYCHITPLI 172 R ++ +V P+Q+H G+ + +C TP I Sbjct: 274 RACDETMSRVFPSQDHTGRPAYWC--TPAI 301 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 23.0 bits (47), Expect = 4.5 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +1 Query: 253 ESNAPATEGSTVDYGLXNKXINSYLFKLILMNINLNY 363 + P STVD + + +N L + +L I+LN+ Sbjct: 1361 DQGIPTPLSSTVDLIVYVRDVNDNLPQFLLKEISLNF 1397 >AY752907-1|AAV30081.1| 97|Anopheles gambiae peroxidase 13A protein. Length = 97 Score = 22.2 bits (45), Expect = 7.9 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +1 Query: 148 VLPHHPLNISEASISKQSEPAKKKTVVPEDKFYSD 252 +LP N S ++ S PA ++T +P+ +SD Sbjct: 63 MLPPDMYNDSMSAEILLSSPAMQQTFIPDHASFSD 97 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 382,917 Number of Sequences: 2352 Number of extensions: 6409 Number of successful extensions: 16 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 34867302 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -