BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_I06 (651 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0003 + 13079-13610,14005-14312,14364-14549,14620-14707,148... 36 0.037 03_01_0527 + 3960982-3961290,3961371-3961464,3961898-3962084,396... 27 9.8 >02_01_0003 + 13079-13610,14005-14312,14364-14549,14620-14707, 14807-14887,14980-15044,15357-15497,15578-15694, 15995-16237,16326-16383,18127-18224 Length = 638 Score = 35.5 bits (78), Expect = 0.037 Identities = 13/27 (48%), Positives = 20/27 (74%) Frame = +2 Query: 32 LQRNPANFIKYQNNPKIAAVIAKLQAK 112 + NPA+F ++Q NPK+ +IAK+ AK Sbjct: 607 VMNNPASFARHQANPKVGPIIAKMMAK 633 >03_01_0527 + 3960982-3961290,3961371-3961464,3961898-3962084, 3962194-3962449,3962561-3962773,3962856-3962942, 3963089-3963223,3963296-3963409,3963507-3963754, 3963824-3963904,3963979-3964210,3964340-3964438, 3964513-3964701,3964928-3965023 Length = 779 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 189 RPPMMTSDLINIS*SLTNILNFAYKIYSIVYLY 287 +PPM DL NIS S N+ A K ++Y+Y Sbjct: 309 QPPMNLPDLKNISSSSINVKVVAKKKRPLIYVY 341 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,642,455 Number of Sequences: 37544 Number of extensions: 172827 Number of successful extensions: 338 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 336 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 338 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -