BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_I06 (651 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. 25 2.1 AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 23 6.3 AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CY... 23 8.4 >DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. Length = 847 Score = 25.0 bits (52), Expect = 2.1 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +1 Query: 532 CICFHKAGYIHAFETALHCSVTDSFHLFNRXDYYLLTPP 648 CI +H++ + + E L+ + LF D Y +PP Sbjct: 369 CIAYHESRFNTSAEGRLNADGSGDHGLFQISDIYWCSPP 407 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 23.4 bits (48), Expect = 6.3 Identities = 8/19 (42%), Positives = 15/19 (78%) Frame = +2 Query: 53 FIKYQNNPKIAAVIAKLQA 109 ++KY+N K++A+ KLQ+ Sbjct: 921 YVKYRNEEKLSALDRKLQS 939 >AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CYP6M1 protein. Length = 503 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +3 Query: 321 LLNFSSFVT*NYSSFSSQHYLNSQITGPSKGRWI 422 LL SF +S + NS I GP +G W+ Sbjct: 460 LLQGFSFAPYEKTSIPMKFITNSFILGPREGLWL 493 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 500,863 Number of Sequences: 2352 Number of extensions: 8386 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -