BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_H24 (558 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18396| Best HMM Match : Ribosomal_L35Ae (HMM E-Value=0) 131 4e-31 SB_21444| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_58335| Best HMM Match : SMC_N (HMM E-Value=0.023) 29 3.4 SB_35470| Best HMM Match : PAN (HMM E-Value=2.9e-08) 28 4.5 >SB_18396| Best HMM Match : Ribosomal_L35Ae (HMM E-Value=0) Length = 115 Score = 131 bits (316), Expect = 4e-31 Identities = 61/104 (58%), Positives = 74/104 (71%) Frame = +2 Query: 179 RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGKHCVYVYRAKKRTPIPGGP 358 RLY K + G+KRGLRNQH NT+L+K+EG +R + FY GK +VYRAK +T G Sbjct: 6 RLYTKGIVLGFKRGLRNQHPNTSLVKIEGVDERKNTEFYLGKRLAFVYRAKNKTVAKGDK 65 Query: 359 RGKKTKLRAIWGKVTRPHGNSGSVRAKFKSNLPAQAMGHRIRVM 490 K TKLR IWGKVTR HGNSG VRAKF+ NLP +AMG +RV+ Sbjct: 66 --KATKLRVIWGKVTRAHGNSGVVRAKFRHNLPPKAMGATVRVI 107 >SB_21444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 333 Score = 29.1 bits (62), Expect = 2.6 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -1 Query: 456 GRLDLNLARTLPELPCGRVTLPQI 385 G DLN+ +T+P + C R+ P++ Sbjct: 257 GLFDLNIGQTIPSVTCRRIPFPEL 280 >SB_58335| Best HMM Match : SMC_N (HMM E-Value=0.023) Length = 354 Score = 28.7 bits (61), Expect = 3.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 281 DAVFYAGKHCVYVYRAKKRTPIPGGPRGKKTKLR 382 D+ F+AG + K P+ GGPR + +LR Sbjct: 168 DSTFWAGPETISRRMLKGEVPVQGGPRKEAKRLR 201 >SB_35470| Best HMM Match : PAN (HMM E-Value=2.9e-08) Length = 614 Score = 28.3 bits (60), Expect = 4.5 Identities = 17/40 (42%), Positives = 20/40 (50%), Gaps = 4/40 (10%) Frame = -3 Query: 445 LELGSDTARVAMWAG----HLAPDSTQLGFFATGTSGNWC 338 L L TA + +W G HLA D + FATG S WC Sbjct: 12 LALRQPTASLNIWEGRAPPHLAVDGVNMSTFATG-STIWC 50 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,521,644 Number of Sequences: 59808 Number of extensions: 350218 Number of successful extensions: 802 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 709 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 799 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1300738331 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -