BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_H22 (593 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 23 2.3 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 22 3.9 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 22 3.9 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 22 5.2 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 22 5.2 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 21 9.1 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 23.0 bits (47), Expect = 2.3 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +1 Query: 175 IKDTFLYFAYGSNLFKKRIRINNPTAEFLGVGRLDNHQL 291 + T+ F Y S K+ +R ++ + GV LDNH + Sbjct: 243 VAGTYAIFLYISWHQKELVRRDSRRKNYGGVYHLDNHHV 281 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 22.2 bits (45), Expect = 3.9 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = -1 Query: 209 LPYAKYKKVSLIGSIILR 156 LPY KYK +++I ++ +R Sbjct: 318 LPYYKYKYLNVINALEMR 335 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 22.2 bits (45), Expect = 3.9 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = -1 Query: 209 LPYAKYKKVSLIGSIILR 156 LPY KYK +++I ++ +R Sbjct: 318 LPYYKYKYLNVINALEMR 335 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 21.8 bits (44), Expect = 5.2 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +3 Query: 531 KW*RITSRKKALHYL 575 +W R+ +K+LHYL Sbjct: 511 QWPRLNPNEKSLHYL 525 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 21.8 bits (44), Expect = 5.2 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +3 Query: 531 KW*RITSRKKALHYL 575 +W R+ +K+LHYL Sbjct: 511 QWPRLNPNEKSLHYL 525 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.0 bits (42), Expect = 9.1 Identities = 7/22 (31%), Positives = 16/22 (72%) Frame = -3 Query: 255 LSCWIVDTDTFFKQITPIRKIQ 190 +SC ++D +TF + I+ + +I+ Sbjct: 312 VSCLVIDRETFNQLISSLDEIR 333 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,749 Number of Sequences: 438 Number of extensions: 2926 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17359926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -