BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_H19 (593 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl c... 24 3.2 AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. 23 5.6 AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7... 23 9.8 >AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl cyclase beta subunit protein. Length = 649 Score = 24.2 bits (50), Expect = 3.2 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 3/47 (6%) Frame = +1 Query: 139 VQQYYTLFDDPAQRANLVNMYNVET---SFMTFEGVQLQGCC*NYGK 270 + + YT+FD+ + N+Y VET +M G L C N+ K Sbjct: 529 LNELYTIFDELTDSKSNSNIYKVETVGDKYMAVSG--LPDECENHAK 573 >AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. Length = 260 Score = 23.4 bits (48), Expect = 5.6 Identities = 18/66 (27%), Positives = 27/66 (40%) Frame = -3 Query: 198 HINKICPLSRIIEQCVILLHKTFTDCIVLRIERHLD*DVSICHTNKKPNSSRKNSRCDEL 19 H K CPL +I T DC+ + + RH +C ++ S+ +S Sbjct: 203 HTAKYCPLKPVI---------TPEDCLAMELRRHKIHRKGVCTASEINLSAGSSSAIVHT 253 Query: 18 TKRGVR 1 KR VR Sbjct: 254 KKRLVR 259 >AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7 protein. Length = 696 Score = 22.6 bits (46), Expect = 9.8 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 416 VLKPLGDSFYVQHDIFRL 469 +L P GD F V++D+F + Sbjct: 598 MLVPKGDQFGVEYDLFAM 615 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 606,465 Number of Sequences: 2352 Number of extensions: 11432 Number of successful extensions: 22 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57188952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -