BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_H16 (644 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC119.17 ||SPBC577.01|metallopeptidase|Schizosaccharomyces pom... 27 2.3 SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pomb... 27 2.3 SPAC4G9.09c |arg11||N-acetyl-gamma-glutamyl-phosphate reductase/... 25 9.3 SPAC110.01 |ppk1|SPAC140.05|serine/threonine protein kinase Ppk1... 25 9.3 >SPBC119.17 ||SPBC577.01|metallopeptidase|Schizosaccharomyces pombe|chr 2|||Manual Length = 992 Score = 27.1 bits (57), Expect = 2.3 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -2 Query: 529 FPHGCLSYISWYCVICCNLSTLCFSLKSGEIAGQVLR 419 FP + Y+ YC C NL T S+ G++ Q+ R Sbjct: 589 FPESLIPYLPVYCDACLNLGTHSESI--GDLEHQIRR 623 >SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pombe|chr 2|||Manual Length = 2386 Score = 27.1 bits (57), Expect = 2.3 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -2 Query: 523 HGCLSYISWYCVICCNLSTLCFSLKSGEI 437 H CL + W I +L + CFSLK+ EI Sbjct: 989 HKCLQGLKW--AIPTSLDSACFSLKAKEI 1015 >SPAC4G9.09c |arg11||N-acetyl-gamma-glutamyl-phosphate reductase/acetylglutamate kinase|Schizosaccharomyces pombe|chr 1|||Manual Length = 885 Score = 25.0 bits (52), Expect = 9.3 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = +3 Query: 234 QLGKCISIGTIPNILQHCIKNHLFCSHPPLTKCK 335 +L + + G + N +HC K L CS+ + K Sbjct: 4 ELQQIVKSGLVRNGAKHCTKRSLLCSNASVIASK 37 >SPAC110.01 |ppk1|SPAC140.05|serine/threonine protein kinase Ppk1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1023 Score = 25.0 bits (52), Expect = 9.3 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +2 Query: 278 TALHQESPILQSSSPN*MQVTSTYCDAT 361 T+LHQ I SSS N MQ +S +T Sbjct: 278 TSLHQSFGIASSSSNNYMQTSSELTSST 305 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,549,499 Number of Sequences: 5004 Number of extensions: 49909 Number of successful extensions: 86 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 83 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 86 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 289756512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -