BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_H10 (651 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P20227 Cluster: TATA-box-binding protein; n=7; Eukaryot... 36 1.1 UniRef50_Q4N3Z0 Cluster: Cation-transporting ATPase; n=1; Theile... 34 3.4 UniRef50_Q4UMX8 Cluster: Valyl-tRNA synthetase; n=1; Rickettsia ... 34 3.4 UniRef50_Q92GR9 Cluster: Valyl-tRNA synthetase; n=18; Rickettsia... 33 7.8 >UniRef50_P20227 Cluster: TATA-box-binding protein; n=7; Eukaryota|Rep: TATA-box-binding protein - Drosophila melanogaster (Fruit fly) Length = 353 Score = 35.5 bits (78), Expect = 1.1 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = +1 Query: 262 MDHMLPSPYNIPGIGTPLHQPEED 333 MD ML ++IP IGTPLHQ E D Sbjct: 1 MDQMLSPNFSIPSIGTPLHQMEAD 24 >UniRef50_Q4N3Z0 Cluster: Cation-transporting ATPase; n=1; Theileria parva|Rep: Cation-transporting ATPase - Theileria parva Length = 2664 Score = 33.9 bits (74), Expect = 3.4 Identities = 20/55 (36%), Positives = 34/55 (61%), Gaps = 2/55 (3%) Frame = -1 Query: 336 LVFFRLMQWCTYSRYVIRT--WQHMIHFSFFTFFIWKLRVSVLVSVDLTVYLLID 178 LV F ++Q + +R+++R+ W H + F FTF I LR+ ++SV L + LI+ Sbjct: 1560 LVTFMIVQHVS-NRFLLRSISWLHTVLFPIFTFVI--LRIPFIISVGLNLIFLIN 1611 >UniRef50_Q4UMX8 Cluster: Valyl-tRNA synthetase; n=1; Rickettsia felis|Rep: Valyl-tRNA synthetase - Rickettsia felis (Rickettsia azadi) Length = 859 Score = 33.9 bits (74), Expect = 3.4 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +2 Query: 362 SNSFNSNSPRHNRHLPLWVRRQL*DLAQSWGLHRGLCTHMHQ 487 S+ F N RH++ P+ +R Q ++ ++W + L H+HQ Sbjct: 521 SDDFTVNKERHDKLFPMELRPQAHEIIRTWAFYTILKAHLHQ 562 >UniRef50_Q92GR9 Cluster: Valyl-tRNA synthetase; n=18; Rickettsiales|Rep: Valyl-tRNA synthetase - Rickettsia conorii Length = 812 Score = 32.7 bits (71), Expect = 7.8 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +2 Query: 362 SNSFNSNSPRHNRHLPLWVRRQL*DLAQSWGLHRGLCTHMHQ 487 S+ F N RH++ P+ +R Q ++ ++W + L H+HQ Sbjct: 474 SDDFAVNKDRHDKLFPMDLRPQAHEIIRTWAFYTILKAHLHQ 515 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 534,694,713 Number of Sequences: 1657284 Number of extensions: 9317015 Number of successful extensions: 27564 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 26220 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27525 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 48760335122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -