BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_G15 (653 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 26 0.31 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 21 6.7 AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory recept... 21 8.9 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 21 8.9 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 25.8 bits (54), Expect = 0.31 Identities = 18/57 (31%), Positives = 26/57 (45%) Frame = +3 Query: 240 NTSVXRDLESVQSQATNQNTQVHAQSTNEEVILEVYLXTDMNRNLGDDQVHVHAPKG 410 +T + R+L S+Q + Q STNE V EV L D N + +H+ G Sbjct: 120 STGLRRNLSSLQ---IGEKIQALDPSTNELVFSEVLLFLDYNPSQKRQFLHITLASG 173 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.4 bits (43), Expect = 6.7 Identities = 12/44 (27%), Positives = 18/44 (40%) Frame = +1 Query: 88 VIYYKIVRYRMG*PIAQLQDKENAPREK*IS*EKTIFKQFGCVV 219 ++Y I + M P+A K P + I K + G VV Sbjct: 255 IVYILIAKTLMHHPVAMTGTKTVMPSQSAIKYRKQVILMLGTVV 298 >AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory receptor candidate 52 protein. Length = 360 Score = 21.0 bits (42), Expect = 8.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -1 Query: 497 MNLIDSWSVIFLISY 453 +N I W ++FLI+Y Sbjct: 221 VNDIFGWQILFLITY 235 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 21.0 bits (42), Expect = 8.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -1 Query: 497 MNLIDSWSVIFLISY 453 +N I W ++FLI+Y Sbjct: 221 VNDIFGWQILFLITY 235 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,968 Number of Sequences: 336 Number of extensions: 2055 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16865010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -