BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_G15 (653 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF378002-1|AAL16724.1| 336|Anopheles gambiae putative transposa... 24 3.7 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 23 6.4 EF117201-1|ABL67438.1| 481|Anopheles gambiae serpin 17 protein. 23 8.4 >AF378002-1|AAL16724.1| 336|Anopheles gambiae putative transposase protein. Length = 336 Score = 24.2 bits (50), Expect = 3.7 Identities = 20/71 (28%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Frame = +3 Query: 219 TIEEKRVNTSVXRDLESVQSQAT-NQNTQVHAQSTNEEVILEVYLXTDMNRNLGDDQVHV 395 T+ R+ + S QS T QN+ + T + + L L DD+ +V Sbjct: 94 TVRRTRLREGIKSYRASKQSNRTIKQNSLI---KTRARKLYDQVLTKFDGCLLMDDETYV 150 Query: 396 HAPKGIVPGQT 428 A G +PGQT Sbjct: 151 KADFGQIPGQT 161 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 23.4 bits (48), Expect = 6.4 Identities = 16/69 (23%), Positives = 33/69 (47%), Gaps = 6/69 (8%) Frame = +3 Query: 210 MRRTIEEKRVNTSVXRD------LESVQSQATNQNTQVHAQSTNEEVILEVYLXTDMNRN 371 MRR E+ R ++ LE+++ A ++ T++ +S E+ +L++Y N Sbjct: 285 MRRQQEQDRAALEASKEMRRKNALEAIR-MAEDRRTRLRRESEIEDALLQIYCEGQQNIA 343 Query: 372 LGDDQVHVH 398 +HV+ Sbjct: 344 SFKQAIHVN 352 >EF117201-1|ABL67438.1| 481|Anopheles gambiae serpin 17 protein. Length = 481 Score = 23.0 bits (47), Expect = 8.4 Identities = 10/33 (30%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +3 Query: 312 QSTNEEVILEVY-LXTDMNRNLGDDQVHVHAPK 407 QS + + +V + T +N+N G +++H+ PK Sbjct: 341 QSAQQLSVADVTEIITSLNQNRGTNKMHLTVPK 373 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 486,348 Number of Sequences: 2352 Number of extensions: 8923 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -