BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_G15 (653 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 4.5 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 6.0 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 6.0 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +3 Query: 531 ILKTLKQKWKRPSKLQ 578 ILK LKQK+ + SKL+ Sbjct: 343 ILKFLKQKYVKNSKLE 358 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = +3 Query: 303 VHAQSTNEEVILEVYLXTDMNR 368 VH++ N ++ Y TD+N+ Sbjct: 90 VHSRDVNVRAVVAQYYDTDVNK 111 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 6.0 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +3 Query: 210 MRRTI-EEKRVNTSVXRDLESVQSQATNQNTQVHAQS 317 MRR + E+KR++ SV D Q + + H Q+ Sbjct: 788 MRRLMSEDKRLSKSVNGDQSQPPHQQLHHHQSTHPQA 824 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,853 Number of Sequences: 438 Number of extensions: 2572 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -