BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_G11 (464 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 23 2.1 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 23 2.1 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 23 2.1 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 23 2.1 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 23 2.1 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 23 2.1 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 23 2.1 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 23 2.1 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 23 2.1 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 23 2.1 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 23 2.1 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 23 2.1 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 23 2.1 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 23 2.1 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 2.8 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 4.9 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 6.5 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 6.5 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 6.5 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 21 6.5 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 6.5 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 21 6.5 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 21 6.5 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 21 6.5 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 21 6.5 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 21 6.5 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 8.6 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 8.6 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.6 bits (46), Expect = 2.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 147 KVKTLTGKEIEIDIEPTDKVERIKXR 224 K K L ++ EID+ K ER++ R Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHR 39 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.6 bits (46), Expect = 2.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 147 KVKTLTGKEIEIDIEPTDKVERIKXR 224 K K L ++ EID+ K ER++ R Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHR 39 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.6 bits (46), Expect = 2.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 147 KVKTLTGKEIEIDIEPTDKVERIKXR 224 K K L ++ EID+ K ER++ R Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHR 39 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 2.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 147 KVKTLTGKEIEIDIEPTDKVERIKXR 224 K K L ++ EID+ K ER++ R Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHR 39 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 2.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 147 KVKTLTGKEIEIDIEPTDKVERIKXR 224 K K L ++ EID+ K ER++ R Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHR 39 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 2.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 147 KVKTLTGKEIEIDIEPTDKVERIKXR 224 K K L ++ EID+ K ER++ R Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHR 39 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 2.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 147 KVKTLTGKEIEIDIEPTDKVERIKXR 224 K K L ++ EID+ K ER++ R Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHR 39 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.6 bits (46), Expect = 2.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 147 KVKTLTGKEIEIDIEPTDKVERIKXR 224 K K L ++ EID+ K ER++ R Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHR 39 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 22.6 bits (46), Expect = 2.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 147 KVKTLTGKEIEIDIEPTDKVERIKXR 224 K K L ++ EID+ K ER++ R Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHR 39 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.6 bits (46), Expect = 2.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 147 KVKTLTGKEIEIDIEPTDKVERIKXR 224 K K L ++ EID+ K ER++ R Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHR 39 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.6 bits (46), Expect = 2.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 147 KVKTLTGKEIEIDIEPTDKVERIKXR 224 K K L ++ EID+ K ER++ R Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHR 39 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.6 bits (46), Expect = 2.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 147 KVKTLTGKEIEIDIEPTDKVERIKXR 224 K K L ++ EID+ K ER++ R Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHR 39 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.6 bits (46), Expect = 2.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 147 KVKTLTGKEIEIDIEPTDKVERIKXR 224 K K L ++ EID+ K ER++ R Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHR 39 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 22.6 bits (46), Expect = 2.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 147 KVKTLTGKEIEIDIEPTDKVERIKXR 224 K K L ++ EID+ K ER++ R Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHR 39 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 22.2 bits (45), Expect = 2.8 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 147 KVKTLTGKEIEIDIEPTDKVERIKXR 224 K K L ++ EID+ K ER++ R Sbjct: 14 KFKQLRNEDNEIDLRSRTKEERLQHR 39 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.4 bits (43), Expect = 4.9 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 114 INNYNSFKMLIKVKTLTGKEIEIDIEPTDKVERIKXR 224 I+NY+ K K L ++ +ID+ K ER++ R Sbjct: 5 ISNYSHHDE--KFKQLRNEDSKIDLRSRTKEERLQHR 39 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.0 bits (42), Expect = 6.5 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 114 INNYNSFKMLIKVKTLTGKEIEIDIEPTDKVERIKXR 224 I+NY+ K K L ++ +ID+ K ER++ R Sbjct: 5 ISNYSHHDE--KFKQLRNEDNKIDLRSRTKEERLQHR 39 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 6.5 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 114 INNYNSFKMLIKVKTLTGKEIEIDIEPTDKVERIKXR 224 I+NY+ K K L ++ +ID+ K ER++ R Sbjct: 5 ISNYSHHDE--KFKQLRNEDNKIDLRSRTKEERLQHR 39 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.0 bits (42), Expect = 6.5 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 114 INNYNSFKMLIKVKTLTGKEIEIDIEPTDKVERIKXR 224 I+NY+ K K L ++ +ID+ K ER++ R Sbjct: 5 ISNYSHHDE--KFKQLRNEDNKIDLRSRTKEERLQHR 39 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.0 bits (42), Expect = 6.5 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 114 INNYNSFKMLIKVKTLTGKEIEIDIEPTDKVERIKXR 224 I+NY+ K K L ++ +ID+ K ER++ R Sbjct: 5 ISNYSHHDE--KFKQLRNEDNKIDLRSRTKEERLQHR 39 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.0 bits (42), Expect = 6.5 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 114 INNYNSFKMLIKVKTLTGKEIEIDIEPTDKVERIKXR 224 I+NY+ K K L ++ +ID+ K ER++ R Sbjct: 5 ISNYSHHDE--KFKQLRNEDNKIDLRSRTKEERLQHR 39 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.0 bits (42), Expect = 6.5 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 114 INNYNSFKMLIKVKTLTGKEIEIDIEPTDKVERIKXR 224 I+NY+ K K L ++ +ID+ K ER++ R Sbjct: 5 ISNYSHHDE--KFKQLRNEDNKIDLRSRTKEERLQHR 39 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.0 bits (42), Expect = 6.5 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 114 INNYNSFKMLIKVKTLTGKEIEIDIEPTDKVERIKXR 224 I+NY+ K K L ++ +ID+ K ER++ R Sbjct: 5 ISNYSHHDE--KFKQLRNEDNKIDLRSRTKEERLQHR 39 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.0 bits (42), Expect = 6.5 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +3 Query: 147 KVKTLTGKEIEIDIEPTDKVERIKXRVXEKEGIPPQQQR 263 K K L ++ +ID+ K ER++ R +E QQ+R Sbjct: 14 KFKQLRNEDNKIDLRSRTKEERLQYR---REAWLVQQER 49 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.0 bits (42), Expect = 6.5 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 114 INNYNSFKMLIKVKTLTGKEIEIDIEPTDKVERIKXR 224 I+NY+ K K L ++ +ID+ K ER++ R Sbjct: 5 ISNYSHHDE--KFKQLRNEDNKIDLRSRTKEERLQHR 39 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.0 bits (42), Expect = 6.5 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +3 Query: 132 FKMLIKVKTLTGKEIEIDIEPTDKVERIKXRVXEKEGIP 248 +K ++K+K L GK+ +I +K+ K + K P Sbjct: 439 YKKMLKIKRLFGKDRKIMDMVREKIIEEKRKNKNKNLTP 477 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 20.6 bits (41), Expect = 8.6 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +3 Query: 147 KVKTLTGKEIEIDIEPTDKVERIKXR 224 K K L ++ +ID+ K ER++ R Sbjct: 14 KFKQLRNEDNKIDLRSRTKEERLQHR 39 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 20.6 bits (41), Expect = 8.6 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +3 Query: 114 INNYNSFKMLIKVKTL 161 I + N FK +IK+KT+ Sbjct: 827 ILDQNKFKDIIKIKTI 842 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,789 Number of Sequences: 438 Number of extensions: 1989 Number of successful extensions: 28 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12436029 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -