BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_G07 (648 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC328.01c ||SPAC3A11.01|karyopherin|Schizosaccharomyces pombe|... 29 0.76 SPAC10F6.03c |||CTP synthase |Schizosaccharomyces pombe|chr 1|||... 26 5.4 SPAC23H3.10 |ssr2||SWI/SNF and RSC complex subunit Ssr2|Schizosa... 25 9.4 >SPAC328.01c ||SPAC3A11.01|karyopherin|Schizosaccharomyces pombe|chr 1|||Manual Length = 1234 Score = 28.7 bits (61), Expect = 0.76 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 374 VCQVLTQGTLFFSAEALD*IY 436 +CQ+L QG +F A+D IY Sbjct: 261 ICQILVQGPIFLKTHAIDCIY 281 >SPAC10F6.03c |||CTP synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 600 Score = 25.8 bits (54), Expect = 5.4 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 81 YLNMRTSHSQYLTTGGIYGSV 143 YLN+ +H +TTG +Y +V Sbjct: 77 YLNVTLTHDNNITTGKVYSNV 97 >SPAC23H3.10 |ssr2||SWI/SNF and RSC complex subunit Ssr2|Schizosaccharomyces pombe|chr 1|||Manual Length = 503 Score = 25.0 bits (52), Expect = 9.4 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +2 Query: 266 GGPRGRNFIQMKWKELTGLLNSDSSGDPKSEDK 364 GG + F++++ K + LN+ PK ED+ Sbjct: 149 GGSSSQEFVKLEEKHYSPSLNAMEQTSPKEEDE 181 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,043,891 Number of Sequences: 5004 Number of extensions: 33073 Number of successful extensions: 76 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 291768710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -