BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_G03 (651 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4G9.03 |adk1||adenylate kinase Adk1|Schizosaccharomyces pomb... 26 4.1 SPAC1952.09c |||acetyl-CoA hydrolase|Schizosaccharomyces pombe|c... 26 5.4 SPCC1223.07c |||aspartate-tRNA ligase |Schizosaccharomyces pombe... 25 7.2 >SPAC4G9.03 |adk1||adenylate kinase Adk1|Schizosaccharomyces pombe|chr 1|||Manual Length = 220 Score = 26.2 bits (55), Expect = 4.1 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 129 GQWAAQDIGKKPRSQWSRV 73 G+WAA D +KP W ++ Sbjct: 194 GKWAAVDAAQKPEQVWEQI 212 >SPAC1952.09c |||acetyl-CoA hydrolase|Schizosaccharomyces pombe|chr 1|||Manual Length = 521 Score = 25.8 bits (54), Expect = 5.4 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -2 Query: 200 H*QVCLPRMPKGLFSISSGLLFNTGNGLLRTLERSP 93 H +V + R+PK L + SG + N N ++ L SP Sbjct: 258 HHEVSVGRLPKNLHPLQSG-IGNIANAIIGGLAHSP 292 >SPCC1223.07c |||aspartate-tRNA ligase |Schizosaccharomyces pombe|chr 3|||Manual Length = 580 Score = 25.4 bits (53), Expect = 7.2 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = +3 Query: 336 SGISSLQDPHLLSKPLNALGVLNSKG-XKVPDAIGLEPKPGPVGGSSDEK 482 SG + DP LL + + ALGV G + DA + P GG E+ Sbjct: 505 SGAQRIHDPELLVERMKALGVSPDVGLQQYIDAFAIGCPPHAGGGIGLER 554 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,602,400 Number of Sequences: 5004 Number of extensions: 49925 Number of successful extensions: 94 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 94 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -