BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_G03 (651 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein p... 27 0.68 AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltr... 23 6.3 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 23 6.3 U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 23 8.4 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 23 8.4 U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette... 23 8.4 >AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein protein. Length = 353 Score = 26.6 bits (56), Expect = 0.68 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +3 Query: 24 GVHTADIVGDYRRNLCLLCSIDSGASFQCPEQP 122 G TAD G+ R +LCL C + C P Sbjct: 298 GHTTADCAGEDRSSLCLHCGAADHRAASCTSDP 330 >AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltransferase protein. Length = 426 Score = 23.4 bits (48), Expect = 6.3 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +3 Query: 468 SSDEKPALGLIDH 506 SSDEKP L L DH Sbjct: 72 SSDEKPTLWLKDH 84 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 23.4 bits (48), Expect = 6.3 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +3 Query: 51 DYRRNLCLLCSIDSGASFQCPEQP 122 D R+N+C+ C + + C QP Sbjct: 679 DDRQNMCIRCGVVGHMAKVCTSQP 702 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 23.0 bits (47), Expect = 8.4 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -2 Query: 476 IGASTNRSRFWFQSYCV 426 +G++ RS +W Q YC+ Sbjct: 409 VGSTGYRSSWWTQFYCI 425 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 23.0 bits (47), Expect = 8.4 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -2 Query: 476 IGASTNRSRFWFQSYCV 426 +G++ RS +W Q YC+ Sbjct: 409 VGSTGYRSSWWTQFYCI 425 >U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette protein protein. Length = 673 Score = 23.0 bits (47), Expect = 8.4 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -2 Query: 476 IGASTNRSRFWFQSYCV 426 +G++ RS +W Q YC+ Sbjct: 387 VGSTGYRSSWWTQFYCI 403 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 665,454 Number of Sequences: 2352 Number of extensions: 14112 Number of successful extensions: 28 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -