BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_G03 (651 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L10986-9|AAK93847.2| 808|Caenorhabditis elegans Spindle assembl... 28 5.0 AJ539470-1|CAD62434.1| 808|Caenorhabditis elegans SAS-4 protein... 28 5.0 >L10986-9|AAK93847.2| 808|Caenorhabditis elegans Spindle assembly abnormal protein 4 protein. Length = 808 Score = 28.3 bits (60), Expect = 5.0 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 5/62 (8%) Frame = -3 Query: 400 NTPNAFKGFERRCGSCSDEIPLLSPKASDRSFNPRSSSEPLALVRP-----GISPA*SAD 236 N FK FERR S + + A+ S P +SSEP P G+ P + + Sbjct: 164 NAAAEFKAFERRMDSMRSASTITTSLATPSSCAPSNSSEPPTRSTPIMNDLGVGPN-NHN 222 Query: 235 WP 230 WP Sbjct: 223 WP 224 >AJ539470-1|CAD62434.1| 808|Caenorhabditis elegans SAS-4 protein protein. Length = 808 Score = 28.3 bits (60), Expect = 5.0 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 5/62 (8%) Frame = -3 Query: 400 NTPNAFKGFERRCGSCSDEIPLLSPKASDRSFNPRSSSEPLALVRP-----GISPA*SAD 236 N FK FERR S + + A+ S P +SSEP P G+ P + + Sbjct: 164 NAAAEFKAFERRMDSMRSASTITTSLATPSSCAPSNSSEPPTRSTPIMNDLGVGPN-NHN 222 Query: 235 WP 230 WP Sbjct: 223 WP 224 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,471,074 Number of Sequences: 27780 Number of extensions: 289481 Number of successful extensions: 634 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 606 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 634 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1444744186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -