BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_F22 (533 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 21 5.2 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 21 6.8 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 21.4 bits (43), Expect = 5.2 Identities = 8/30 (26%), Positives = 19/30 (63%) Frame = -3 Query: 96 TVLTILSCSTSFTVTGTHLALCWQPEERTS 7 T+L I++CS + + + +C++ ++R S Sbjct: 271 TILLIMTCSGVHSESQKLVGVCYEYQDRFS 300 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 21.0 bits (42), Expect = 6.8 Identities = 11/44 (25%), Positives = 18/44 (40%) Frame = -1 Query: 323 CRNVKV*LHYVCAHRRSW*QS*LQQVSECKYDEGWQHNAHRTNQ 192 C N++ C+ W L + +C Y EGW + +Q Sbjct: 200 CDNLQYSFDNQCSGTIDWA---LPKQEDCFYQEGWNGQSFDVSQ 240 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,330 Number of Sequences: 336 Number of extensions: 2347 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12992348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -