BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_F22 (533 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g15520.1 68418.m01817 40S ribosomal protein S19 (RPS19B) 40S ... 152 1e-37 At3g02080.1 68416.m00173 40S ribosomal protein S19 (RPS19A) simi... 151 2e-37 At5g61170.1 68418.m07674 40S ribosomal protein S19 (RPS19C) 40S ... 150 7e-37 At1g14300.1 68414.m01695 expressed protein contains Pfam PF04063... 30 0.84 At4g16095.1 68417.m02440 disease resistance protein-related cont... 29 1.5 At5g45800.1 68418.m05632 leucine-rich repeat transmembrane prote... 29 1.9 At5g16500.1 68418.m01928 protein kinase family protein contains ... 27 5.9 >At5g15520.1 68418.m01817 40S ribosomal protein S19 (RPS19B) 40S RIBOSOMAL PROTEIN S19 - Oryza sativa, SWISSPROT:RS19_ORYSA Length = 143 Score = 152 bits (369), Expect = 1e-37 Identities = 68/130 (52%), Positives = 91/130 (70%) Frame = +2 Query: 56 TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAILRHI 235 TVKDV VK A+HLK++GK+++P D+VKT R KELAPYDPDW+Y+R A++ R I Sbjct: 6 TVKDVSPHDFVKAYASHLKRSGKIELPLWTDIVKTGRLKELAPYDPDWYYIRAASMARKI 65 Query: 236 YIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALKLVEKVQDGGRILT 415 Y+R +GV +I+GG KRNG P HFC+SSG IAR LQ LE + +VE GGR +T Sbjct: 66 YLRGGLGVGAFRRIYGGSKRNGSRPPHFCKSSGGIARHILQQLETMSIVELDTKGGRRIT 125 Query: 416 TQXRRXLDRI 445 + +R LD++ Sbjct: 126 SSGQRDLDQV 135 >At3g02080.1 68416.m00173 40S ribosomal protein S19 (RPS19A) similar to 40S ribosomal protein S19 GB:P40978 [Oryza sativa] Length = 143 Score = 151 bits (367), Expect = 2e-37 Identities = 66/130 (50%), Positives = 91/130 (70%) Frame = +2 Query: 56 TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAILRHI 235 TVKDV VK A+HLK++GK+++P D+VKT + KELAPYDPDW+Y+R A++ R + Sbjct: 6 TVKDVSPHDFVKAYASHLKRSGKIELPTWTDIVKTGKLKELAPYDPDWYYIRAASMARKV 65 Query: 236 YIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALKLVEKVQDGGRILT 415 Y+R +GV +I+GG KRNG P HFC+SSG IAR LQ LE + +VE GGR +T Sbjct: 66 YLRGGLGVGAFRRIYGGSKRNGSRPPHFCKSSGGIARHILQQLETMNIVELDTKGGRRIT 125 Query: 416 TQXRRXLDRI 445 + +R LD++ Sbjct: 126 SSGQRDLDQV 135 >At5g61170.1 68418.m07674 40S ribosomal protein S19 (RPS19C) 40S ribsomal protein S19, Oryza sativa, SWISSPROT:RS19_ORYSA Length = 143 Score = 150 bits (363), Expect = 7e-37 Identities = 64/130 (49%), Positives = 92/130 (70%) Frame = +2 Query: 56 TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAILRHI 235 TVKDV + VK AAHLK++GK+++P D+VKT + KELAPYDPDW+Y+R A++ R + Sbjct: 6 TVKDVSPHEFVKAYAAHLKRSGKIELPLWTDIVKTGKLKELAPYDPDWYYIRAASMARKV 65 Query: 236 YIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALKLVEKVQDGGRILT 415 Y+R +GV +I+GG KRNG P HFC+SSG +AR LQ L+ + +V+ GGR +T Sbjct: 66 YLRGGLGVGAFRRIYGGSKRNGSRPPHFCKSSGGVARHILQQLQTMNIVDLDTKGGRKIT 125 Query: 416 TQXRRXLDRI 445 + +R LD++ Sbjct: 126 SSGQRDLDQV 135 >At1g14300.1 68414.m01695 expressed protein contains Pfam PF04063: Domain of unknown function (DUF383) and PF04064: Domain of unknown function (DUF384) Length = 339 Score = 30.3 bits (65), Expect = 0.84 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +2 Query: 317 FCRSSGSIARKALQSLEALKL-VEKVQDGGRILTTQXRRXLDRI 445 FCRSSG A + + ++ + + K +DG ++L RR L +I Sbjct: 143 FCRSSGETADDQFEHVGSILVNISKTEDGRKLLLEPKRRLLKQI 186 >At4g16095.1 68417.m02440 disease resistance protein-related contains weak similarity to rpp8 [Arabidopsis thaliana] gi|3901294|gb|AAC78631 Length = 187 Score = 29.5 bits (63), Expect = 1.5 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -1 Query: 401 HRPELSQQASMPPTIAKPCVQYCLM 327 H P L Q PP + C++YC M Sbjct: 86 HMPRLPDQHRFPPNLTNICLRYCCM 110 >At5g45800.1 68418.m05632 leucine-rich repeat transmembrane protein kinase, putative Length = 666 Score = 29.1 bits (62), Expect = 1.9 Identities = 12/50 (24%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +2 Query: 101 AHLKKTGKVKVPEHMDLVK-TARFKELAPYDPDWFYVRCAAILRHIYIRS 247 +H + V P D + T F+ ++ ++ WF C+A++ H+ + S Sbjct: 15 SHSDSSSTVSCPNGTDFHQLTTVFRYVSGFNSSWFSSNCSAVITHVVLPS 64 >At5g16500.1 68418.m01928 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 636 Score = 27.5 bits (58), Expect = 5.9 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 5/54 (9%) Frame = +2 Query: 35 KARCVPVTVKD-----VEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELA 181 K+R P T + VE D+ V A K+T + + E VKT F+ELA Sbjct: 15 KSRNAPCTTNETNDDNVEHDEFRPPVVATTKRTEEREPAEQQPPVKTFNFRELA 68 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,910,381 Number of Sequences: 28952 Number of extensions: 209625 Number of successful extensions: 479 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 474 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 479 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 984125600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -