BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_F21 (488 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_349| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_17361| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 >SB_349| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 28.3 bits (60), Expect = 3.6 Identities = 19/54 (35%), Positives = 25/54 (46%) Frame = -1 Query: 269 QPTEFLAGSSQWVAFPIRW*ILRSHPVAMASVSNTSLSTILLEVRTSICFLLVY 108 +PT F +G + +V P S V VS T STIL S CF+ +Y Sbjct: 20 KPTMFQSGKTTFVRKPSEAATTESSTVPQTVVSETKSSTILRGAYLS-CFITLY 72 >SB_17361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 27.5 bits (58), Expect = 6.3 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = -2 Query: 367 SS*STIGAFRYRKHWSPFLSKPRASASKLTHRHSPLSFSP 248 SS ST+ K WS PRA A+ + +P FSP Sbjct: 3 SSASTMAIKDTGKQWSAIAYFPRAMATNTQEKETPSIFSP 42 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,534,614 Number of Sequences: 59808 Number of extensions: 248376 Number of successful extensions: 586 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 537 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 586 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1038380485 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -