BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_F18 (418 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27622| Best HMM Match : Ribosomal_S25 (HMM E-Value=0) 131 3e-31 SB_32247| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.38 SB_45659| Best HMM Match : E_Pc_C (HMM E-Value=1.2) 28 2.7 SB_34145| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_10354| Best HMM Match : AT_hook (HMM E-Value=0.045) 28 3.6 SB_14817| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_58990| Best HMM Match : SH3_1 (HMM E-Value=1.7e-14) 27 8.2 SB_42739| Best HMM Match : 7tm_1 (HMM E-Value=3.9e-21) 27 8.2 SB_36821| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 >SB_27622| Best HMM Match : Ribosomal_S25 (HMM E-Value=0) Length = 115 Score = 131 bits (316), Expect = 3e-31 Identities = 67/115 (58%), Positives = 76/115 (66%) Frame = +1 Query: 22 PPKKDAKASAKQPQXXXXXXXXXXXXXXXXXXXXXXXXXXXLNNQVLFDKPTYXKLYKEV 201 PPKKD K AK+PQ LNN VLFDK TY KLYKEV Sbjct: 1 PPKKDPKKDAKKPQKAQKPAGSGGGKAKKKKWSKGKVRDK-LNNLVLFDKATYDKLYKEV 59 Query: 202 PQYKLITPAVVSERLKVRGSLXRRALIELREKGLIKQVVQHHGQVIYTRATKGDD 366 P Y+LITP+VVSERLK+RGSL RRAL+EL+ KGLIK+V +HH Q+IYTRATKG D Sbjct: 60 PSYRLITPSVVSERLKIRGSLARRALLELQSKGLIKEVSKHHSQLIYTRATKGAD 114 >SB_32247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2209 Score = 31.1 bits (67), Expect = 0.38 Identities = 19/68 (27%), Positives = 30/68 (44%) Frame = -3 Query: 326 WCWTTCLMRPFSLSSMSALLXREPRTFNLSDTTAGVISLYCGTSLYSXSYVGLSNNTWLF 147 WC +RPF LSS++ L R + ++ GV GT S G++ W Sbjct: 2144 WCGPVYFVRPFCLSSIAYRLIRA-----IMSSSLGVACSPVGTKAPGVSSGGITRTIWSA 2198 Query: 146 NLSRTFPL 123 + +R P+ Sbjct: 2199 SRTREMPV 2206 >SB_45659| Best HMM Match : E_Pc_C (HMM E-Value=1.2) Length = 1244 Score = 28.3 bits (60), Expect = 2.7 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -3 Query: 200 TSLYSXSYVGLSNNTWLFNLSRTFPLDH 117 +SL+ G+SN+ WL N S T P++H Sbjct: 250 SSLHIEKENGISNDDWLSNPSFTSPIEH 277 >SB_34145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 679 Score = 27.9 bits (59), Expect = 3.6 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -2 Query: 405 FYFFNLYHSLCDWIIALGRTRV 340 FY+F++ CDW A R RV Sbjct: 289 FYWFSMQQRRCDWFAAKSRQRV 310 >SB_10354| Best HMM Match : AT_hook (HMM E-Value=0.045) Length = 191 Score = 27.9 bits (59), Expect = 3.6 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 4 FPTSKMPPKKDAKASAKQPQ 63 F SKMP KK AKA+ QP+ Sbjct: 47 FAISKMPSKKGAKAAEAQPE 66 >SB_14817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 594 Score = 26.6 bits (56), Expect = 8.2 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 53 NSLKKHRRRRKDPVAAKPRRRSGPK 127 N KH ++K PV P+R GPK Sbjct: 304 NDKHKHNSKQKTPVVYFPKRPYGPK 328 >SB_58990| Best HMM Match : SH3_1 (HMM E-Value=1.7e-14) Length = 167 Score = 26.6 bits (56), Expect = 8.2 Identities = 15/60 (25%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = -3 Query: 293 SLSSMSALLXREPRTFNLSDTTAGVISLYCGT-SLYSXSYVGLSNNTWLFNLSRTFPLDH 117 +L+ +L RE L + + I + S++ +Y GL N W +PL H Sbjct: 100 TLTKNISLFSREIEVTTLKEHISCAIKCFVIVMSMFLPNYAGLRRNLWFTRKKPNYPLPH 159 >SB_42739| Best HMM Match : 7tm_1 (HMM E-Value=3.9e-21) Length = 683 Score = 26.6 bits (56), Expect = 8.2 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = -3 Query: 155 WLFNLSRTFPLDHFFFLALPPPDPSFFFC--VF*GCLAEAFASF 30 WL + TFPL + + + P DP ++C +F G +F S+ Sbjct: 154 WLAATAITFPLFMYSKMVMSPFDPDTYWCFVLFPGDSLSSFPSY 197 >SB_36821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1503 Score = 26.6 bits (56), Expect = 8.2 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 206 CGTSLYSXSYVGLSNNTWLFNLSRTFP 126 CG + +Y GL N W+ ++R P Sbjct: 1248 CGKRTFMPNYAGLRGNLWITRITRKKP 1274 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,735,747 Number of Sequences: 59808 Number of extensions: 257801 Number of successful extensions: 802 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 693 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 800 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 777158991 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -