BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_F17 (456 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 22 2.4 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 4.1 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 22.2 bits (45), Expect = 2.4 Identities = 10/37 (27%), Positives = 16/37 (43%) Frame = -1 Query: 354 IICPFLXLSPPSSKCLHLFNATCDLTLQSAHSRRSTI 244 ++C L L PP+ + L N + H R T+ Sbjct: 334 VVCESLRLWPPAPQTDRLCNKNFVIEASKPHERTFTV 370 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.4 bits (43), Expect = 4.1 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +3 Query: 195 VVSPNPSSKRRQKPLRKLCSVLSVPIAR*DHRLH*RD 305 +VS ++ R+ PL+KLC+ + HR H D Sbjct: 138 MVSCKDAALRKVVPLKKLCNNGTCEDIGNSHRCHCSD 174 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,747 Number of Sequences: 336 Number of extensions: 1683 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10406187 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -