BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_F14 (655 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0849 - 11768191-11771412 27 9.9 >03_02_0849 - 11768191-11771412 Length = 1073 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/32 (31%), Positives = 21/32 (65%) Frame = -2 Query: 210 LHRRKFRYLSICCSRPLFEKLDLVIHFDNIQI 115 ++R RY+SI C + +L ++ +++NI+I Sbjct: 524 INRDLVRYVSILCQKDELPELTMICNYENIRI 555 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,906,200 Number of Sequences: 37544 Number of extensions: 215948 Number of successful extensions: 560 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 554 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 560 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1632177336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -