BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_F14 (655 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g61340.1 68418.m07697 expressed protein 28 4.7 At5g55490.1 68418.m06911 expressed protein 27 8.2 >At5g61340.1 68418.m07697 expressed protein Length = 326 Score = 28.3 bits (60), Expect = 4.7 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = -1 Query: 643 NCFKNFSFXVINLFILASFSSSVRFSLLGXNAFVLITVLL 524 N + F F N + S SS++ +S++ NAFV+ + L Sbjct: 153 NTLEAFGFSSRNFYTFLSLSSAIIYSIIIANAFVISNLAL 192 >At5g55490.1 68418.m06911 expressed protein Length = 537 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/34 (29%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +3 Query: 153 SQTMVDYSKWKDIEISDDEDE-THPNIDTPSLFR 251 +++ VD++ W D +++DD+D P+ P L + Sbjct: 485 TESEVDWTSWVDTDLTDDDDNLADPDYKIPLLIK 518 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,761,998 Number of Sequences: 28952 Number of extensions: 179275 Number of successful extensions: 465 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 456 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 464 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -