BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_F09 (527 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT022230-1|AAY54646.1| 346|Drosophila melanogaster IP12463p pro... 28 9.0 AE014296-1415|AAF50449.1| 346|Drosophila melanogaster CG7194-PA... 28 9.0 >BT022230-1|AAY54646.1| 346|Drosophila melanogaster IP12463p protein. Length = 346 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -3 Query: 150 LKTKLNKFILAKVHHISTEQNILQFKICMGNQS 52 L+ + +F LAK H++ N + KIC+ N S Sbjct: 287 LRARRLEFFLAKDHNVFNRMNQNEIKICLENAS 319 >AE014296-1415|AAF50449.1| 346|Drosophila melanogaster CG7194-PA protein. Length = 346 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -3 Query: 150 LKTKLNKFILAKVHHISTEQNILQFKICMGNQS 52 L+ + +F LAK H++ N + KIC+ N S Sbjct: 287 LRARRLEFFLAKDHNVFNRMNQNEIKICLENAS 319 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,464,990 Number of Sequences: 53049 Number of extensions: 343392 Number of successful extensions: 590 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 588 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 590 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1970722560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -