BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_F06 (643 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 26 0.36 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 26 0.36 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 25 0.47 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 25 0.82 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 25 0.82 AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 23 3.3 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 22 4.4 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 25.8 bits (54), Expect = 0.36 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = -2 Query: 423 VSWSNGRQFPAWPDYSQFGNTFRVYMLRQVN*ELRIVPFATSGLLL 286 +++SNG FP P +S F Y+ +N E RI SG +L Sbjct: 299 MTYSNGLPFPQRPIWSNFPIYKYKYIREIMNKESRISAAIDSGYIL 344 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 25.8 bits (54), Expect = 0.36 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = -2 Query: 423 VSWSNGRQFPAWPDYSQFGNTFRVYMLRQVN*ELRIVPFATSGLLL 286 +++SNG FP P +S F Y+ +N E RI SG +L Sbjct: 299 MTYSNGLPFPQRPIWSNFPIYKYKYIREIMNKESRISAAIDSGYIL 344 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 25.4 bits (53), Expect = 0.47 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 616 SKVSIRNEFPKDSSSCVISLXSIGFSWSVRCFFIG 512 SKVS R E +D ++ ++SL ++W IG Sbjct: 364 SKVSARIEMNEDDNTSLVSLDKKQYTWRHTSVLIG 398 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 24.6 bits (51), Expect = 0.82 Identities = 15/47 (31%), Positives = 20/47 (42%) Frame = +2 Query: 461 GLVQVCSHSKTTAYSASSNKETSNRPRKSD*XXRNNAR*GIFREFVP 601 G CS+S++ S SS SNR S R + G E +P Sbjct: 16 GYSNTCSNSQSQRSSGSSISRNSNRSESSGYCGRRPSTFGSSNEALP 62 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 24.6 bits (51), Expect = 0.82 Identities = 15/47 (31%), Positives = 20/47 (42%) Frame = +2 Query: 461 GLVQVCSHSKTTAYSASSNKETSNRPRKSD*XXRNNAR*GIFREFVP 601 G CS+S++ S SS SNR S R + G E +P Sbjct: 16 GYSNTCSNSQSQRSSGSSISRNSNRSESSGYCGRRPSTFGSSNEALP 62 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 22.6 bits (46), Expect = 3.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 446 SNNKPGLVQVCSHSKTTAYSASS 514 S+ PG +Q C+ S TA SS Sbjct: 20 SSANPGTIQACTTSPATASLESS 42 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 22.2 bits (45), Expect = 4.4 Identities = 8/14 (57%), Positives = 11/14 (78%), Gaps = 1/14 (7%) Frame = +3 Query: 108 SH-VFGNLIPPNIC 146 SH + GNL+PP +C Sbjct: 358 SHPLHGNLLPPGVC 371 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,936 Number of Sequences: 438 Number of extensions: 3616 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19315974 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -