BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_E23 (650 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPMIT.11 |cox2||cytochrome c oxidase 2|Schizosaccharomyces pombe... 111 1e-25 SPBC1711.12 |||serine peptidase |Schizosaccharomyces pombe|chr 2... 25 7.2 >SPMIT.11 |cox2||cytochrome c oxidase 2|Schizosaccharomyces pombe|chr mitochondrial|||Manual Length = 248 Score = 111 bits (266), Expect = 1e-25 Identities = 57/153 (37%), Positives = 81/153 (52%), Gaps = 5/153 (3%) Frame = +3 Query: 207 PAFTLIFIAXXXXXXXXXXXXXXXXXITLKSIGHQ*Y*RYEYSDF-----NNIEFDSYII 371 PA LI +A +T+K+IG Q + YE +DF + FDSY++ Sbjct: 85 PALILILVALPSFKLLYLLDEVQKPSMTVKAIGRQWFWSYELNDFVTNENEPVSFDSYMV 144 Query: 372 PSNEIKNNEFRLLXVDXXXXXXXXXXXXXXXTATDVIHS*TIPSLGIKVDANPGRLNQTN 551 P +++ R L VD T+ DVIHS +PSLGIK D P RLNQ + Sbjct: 145 PEEDLEEGSLRQLEVDNRLVLPIDTRIRLILTSGDVIHSWAVPSLGIKCDCIPSRLNQVS 204 Query: 552 FFINRPGIFFGQCSXICGANHSFIPIVIESISI 650 I+R G+F+GQCS +CG HS +PIV++ +S+ Sbjct: 205 LSIDREGLFYGQCSELCGVLHSSMPIVVQGVSL 237 >SPBC1711.12 |||serine peptidase |Schizosaccharomyces pombe|chr 2|||Manual Length = 683 Score = 25.4 bits (53), Expect = 7.2 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -2 Query: 445 LFIGKIIRLSTXNSRNSLFFISLDGIIYESNSILLKSE 332 LF+ R +T SRN+L+FI LD SN + SE Sbjct: 165 LFVRHWDRWNT-GSRNTLYFIELDKKTENSNYFEISSE 201 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,911,185 Number of Sequences: 5004 Number of extensions: 31582 Number of successful extensions: 52 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 52 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -