BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_E21 (640 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2G5.05 |||transketolase |Schizosaccharomyces pombe|chr 2|||M... 31 0.11 SPAC4D7.01c |sec71|sec7a, SPAP8A3.15c|Sec7 domain|Schizosaccharo... 28 1.3 SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo... 25 7.0 SPAC32A11.01 |mug8||conserved fungal protein|Schizosaccharomyces... 25 9.2 SPAC1039.08 |||serine acetyltransferase |Schizosaccharomyces pom... 25 9.2 >SPBC2G5.05 |||transketolase |Schizosaccharomyces pombe|chr 2|||Manual Length = 685 Score = 31.5 bits (68), Expect = 0.11 Identities = 14/35 (40%), Positives = 23/35 (65%), Gaps = 5/35 (14%) Frame = +2 Query: 452 RWLHEAYGLGRFGYAQP-----ERFHYSISGXQER 541 R++HEA+G+ FG + P E+FH++ SG +R Sbjct: 629 RYVHEAFGMHTFGDSGPAPKLYEKFHFTTSGVAQR 663 >SPAC4D7.01c |sec71|sec7a, SPAP8A3.15c|Sec7 domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 1811 Score = 27.9 bits (59), Expect = 1.3 Identities = 15/50 (30%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = +2 Query: 269 HELHR*ELLQVRSDRSHHCRHYCFHCRVLRLLWRCQREPLH-DNNVFSIP 415 HE+ R V + HH + C + L+ C E H DN + +IP Sbjct: 1594 HEISRFNSQSVFKSKKHHLKSIVVKCTLQLLMLNCLWELFHSDNMLTNIP 1643 Score = 26.2 bits (55), Expect = 4.0 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = -3 Query: 515 NGSVQVAHNRIFQVRMLHVTSDAHSQFSHEYDQEE 411 +GS+ + H++ FQ H T + + EY E Sbjct: 1111 SGSISLKHSKSFQSASTHSTKSSSVEIVREYSSRE 1145 >SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1224 Score = 25.4 bits (53), Expect = 7.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 370 APQQPKNATMKTIMPTMMRT 311 AP QPK + +I+PT+ RT Sbjct: 810 APVQPKTSQASSILPTVPRT 829 >SPAC32A11.01 |mug8||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 720 Score = 25.0 bits (52), Expect = 9.2 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = -2 Query: 75 NKMSSQPAANKGXSRATVSSASNKF 1 N +++ P ++G + TVSSAS+ F Sbjct: 568 NMLNTLPPTSQGATSTTVSSASSNF 592 >SPAC1039.08 |||serine acetyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 270 Score = 25.0 bits (52), Expect = 9.2 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +2 Query: 401 VFSIPLDHIRG*TGCGHRWLHEAYGL 478 V ++PLDH+ G + W + GL Sbjct: 55 VLALPLDHVTGSSESMENWFYSILGL 80 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,227,295 Number of Sequences: 5004 Number of extensions: 38921 Number of successful extensions: 95 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 91 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 95 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 285732116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -