BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_E21 (640 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1422 + 33453498-33453519,33453617-33454887 28 5.4 01_07_0004 - 40354253-40354353,40354598-40354670,40356196-403563... 28 7.2 05_04_0198 + 18973973-18974592,18974992-18975440,18976031-189761... 27 9.5 >04_04_1422 + 33453498-33453519,33453617-33454887 Length = 430 Score = 28.3 bits (60), Expect = 5.4 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = -3 Query: 614 IGPVGRTVYTAALQVCLYDINSXXDVLVYRILSNGSVQ 501 IG +GRT + +++ + ++ LVY L NGS++ Sbjct: 140 IGTIGRTYHVHLVRLYGFCFDADTKALVYEFLENGSLE 177 >01_07_0004 - 40354253-40354353,40354598-40354670,40356196-40356319, 40357821-40358222,40358704-40358732 Length = 242 Score = 27.9 bits (59), Expect = 7.2 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = +1 Query: 133 PLARLELSLLLNVPSXFCFNSPCFAXYGIDHPDS 234 PL LE +LLL +PS FCF + C G P S Sbjct: 158 PLEPLEFALLL-LPSPFCFANICNPKQGKVSPGS 190 >05_04_0198 + 18973973-18974592,18974992-18975440,18976031-18976166, 18976252-18976323,18976389-18976457,18976546-18976617, 18978192-18978250,18978643-18978734 Length = 522 Score = 27.5 bits (58), Expect = 9.5 Identities = 21/60 (35%), Positives = 25/60 (41%), Gaps = 4/60 (6%) Frame = +2 Query: 26 VARLXPLLAAGCELILFPLANYNFGR*LFNFELTTGPSQG----WNCPCC*TYPHXFAST 193 ++ L PL+ AG LFPL Y F R E Q WN C PH +A T Sbjct: 330 ISGLPPLINAGEVFGLFPLGGYTFPRDAHALEAIKRSLQNIPDDWNGDPC--MPHGYAWT 387 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,697,023 Number of Sequences: 37544 Number of extensions: 265128 Number of successful extensions: 667 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 651 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 667 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1573040476 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -