BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_E18 (444 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07751.1 68415.m00901 NADH-ubiquinone oxidoreductase chain 3,... 36 0.016 >At2g07751.1 68415.m00901 NADH-ubiquinone oxidoreductase chain 3, putative identical to NADH-ubiquinone oxidoreductase chain 3 SP:P48908 from [Raphanus sativus]; contains Pfam profile: PF00507 NADH-ubiquinone/plastoquinone oxidoreductase,chain 3 Length = 118 Score = 35.5 bits (78), Expect = 0.016 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +2 Query: 104 EKCSPFECGFDPKSISRIPFSLHXXXXXXXXXXXDVEIALIFP 232 EK S +ECGFDP +R F + D+E+ FP Sbjct: 37 EKLSAYECGFDPSGDARSRFDIRFYLVSILFLIPDLEVTFFFP 79 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,401,214 Number of Sequences: 28952 Number of extensions: 35453 Number of successful extensions: 63 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 62 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 63 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 712739520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -