BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_E16 (434 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 22 3.4 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 21 4.5 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 21.8 bits (44), Expect = 3.4 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = -2 Query: 199 LFPSIPQLFSSHSQPAYLG 143 + P P+L+ H P +LG Sbjct: 9 ILPLNPKLYDKHRAPKFLG 27 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 21.4 bits (43), Expect = 4.5 Identities = 16/62 (25%), Positives = 28/62 (45%) Frame = -1 Query: 200 TFSLNSSIVFFALSASVFRLLSSLGASRLTNACTLARQIANKIISSVVHFG*FENVFTKS 21 +F+L S I ALS L S +S N + + ++ ++ VH+ EN+ Sbjct: 244 SFTLQSGIFGMALSPLTQNLYYSALSSHNLNYVNTEQFVKSQYQANNVHYQGKENILWTQ 303 Query: 20 AT 15 A+ Sbjct: 304 AS 305 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,186 Number of Sequences: 438 Number of extensions: 1897 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 11368164 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -