BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_E14 (656 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0351 + 2790469-2790534,2791089-2791173,2791921-2792021,279... 30 1.9 12_02_0535 + 20117205-20117401,20118556-20118628,20118725-201187... 29 3.3 05_03_0368 - 13127536-13128429 28 5.7 01_05_0147 + 18597194-18597643,18598347-18598681,18600073-186001... 28 5.7 12_02_1280 - 27517683-27517871,27517955-27518029,27518155-275183... 28 7.5 03_05_0459 + 24533233-24533278,24533881-24534167,24534287-245345... 27 9.9 >01_01_0351 + 2790469-2790534,2791089-2791173,2791921-2792021, 2792601-2792683,2792829-2792874,2792969-2793025, 2793118-2793172,2793244-2793344,2793432-2793495, 2793604-2793737,2794158-2794346 Length = 326 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = +3 Query: 219 LLXN*YVKLFKAPLELKSLVRQVGLKPLLKKPTNVFW 329 +L N +VKLF+ PL+ K + + L++ TNVFW Sbjct: 77 ILANHFVKLFEVPLDGKEVSLRYS-SALVQGATNVFW 112 >12_02_0535 + 20117205-20117401,20118556-20118628,20118725-20118787, 20119167-20119220,20119303-20119359,20119615-20119707 Length = 178 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = +2 Query: 353 GSNKYHFKSHRRSHKSPTRERRSESSIHKDKSKRK 457 G ++ H KS R S KS RER + +DKSK K Sbjct: 77 GKSRKHKKS-RSSRKSRERERSKDRHSKRDKSKHK 110 >05_03_0368 - 13127536-13128429 Length = 297 Score = 28.3 bits (60), Expect = 5.7 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 383 RRSHKSPTRERRSESSIHKDKSKRKR 460 RRS + ++ RRS S K KS+RKR Sbjct: 203 RRSSRGRSKHRRSSSKEDKKKSRRKR 228 >01_05_0147 + 18597194-18597643,18598347-18598681,18600073-18600147, 18600325-18600427,18601554-18601642,18602953-18603064, 18604093-18604146,18604271-18604319,18606236-18606347, 18606389-18606436,18607000-18607327 Length = 584 Score = 28.3 bits (60), Expect = 5.7 Identities = 16/56 (28%), Positives = 28/56 (50%) Frame = +2 Query: 293 KAPPQKTNKRFLVNTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSIHKDKSKRKR 460 ++P +++ R + R A S++ H H HKS R RRS + + +R+R Sbjct: 49 RSPDRRSRSRSSGSKRRKASSSSRRHRHHH---HKSSGRSRRSRDDDDERRRRRRR 101 >12_02_1280 - 27517683-27517871,27517955-27518029,27518155-27518318, 27518424-27518538,27518783-27519074,27519162-27519318, 27519438-27519510,27520309-27520377,27520471-27520694, 27520800-27520981,27521067-27522064,27522335-27522580 Length = 927 Score = 27.9 bits (59), Expect = 7.5 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +2 Query: 377 SHRRSHKSPTRERRSESSIHKDKSKRKR 460 +H +S ERRS SS HKD +R R Sbjct: 296 AHHIRDESRESERRSSSSRHKDNERRDR 323 >03_05_0459 + 24533233-24533278,24533881-24534167,24534287-24534568, 24534628-24534682,24534895-24534935,24537484-24537549 Length = 258 Score = 27.5 bits (58), Expect = 9.9 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +2 Query: 374 KSHRRSHKSPTRERRSESSIHKDKSKRK 457 K H+ HK ++++ E K+K K+K Sbjct: 149 KKHKHRHKDRSKDKEKEKEKEKEKEKKK 176 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,457,008 Number of Sequences: 37544 Number of extensions: 217319 Number of successful extensions: 455 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 434 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 454 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1644004708 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -