BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_E14 (656 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 24 1.5 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 24 1.5 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 24 1.5 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 23 1.9 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 23 1.9 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 23 1.9 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 23 1.9 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 23 1.9 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 23 1.9 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 23 3.4 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 23 3.4 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 23 3.4 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 22 4.5 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 22 4.5 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 22 4.5 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 22 4.5 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 22 4.5 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 22 4.5 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 22 4.5 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 22 4.5 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 22 4.5 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 22 4.5 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 22 4.5 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 22 5.9 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 22 5.9 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 22 5.9 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 22 5.9 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 22 5.9 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 22 5.9 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 22 5.9 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 22 5.9 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 21 7.8 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 21 7.8 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 21 7.8 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 21 7.8 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 21 7.8 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 21 7.8 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 21 7.8 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 21 7.8 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 21 7.8 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 21 7.8 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 7.8 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 7.8 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 21 7.8 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 23.8 bits (49), Expect = 1.5 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSI 433 N+ +N KY +S RS RER E I Sbjct: 48 NSYKNEKEYRKYRERSKERSRDKRERERSKERKI 81 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 23.8 bits (49), Expect = 1.5 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSI 433 N+ +N KY +S RS RER E I Sbjct: 48 NSYKNEKEYRKYRERSKERSRDKRERERSKERKI 81 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 23.8 bits (49), Expect = 1.5 Identities = 13/41 (31%), Positives = 17/41 (41%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSIHKDKSKR 454 N+ +N KY +S RS RER E I S + Sbjct: 281 NSYKNEREYRKYRERSKERSRDRTERERSREPKIISSLSNK 321 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.4 bits (48), Expect = 1.9 Identities = 16/57 (28%), Positives = 19/57 (33%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSIHKDKSKRKR*NGXL*YTTSXKKY 502 N+ +N KY S RS RER E I S N Y + Y Sbjct: 47 NSYKNEREYRKYRETSKERSRDRTERERSREPKIISSLSNNTIHNNNYKYNYNNNNY 103 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.4 bits (48), Expect = 1.9 Identities = 16/57 (28%), Positives = 19/57 (33%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSIHKDKSKRKR*NGXL*YTTSXKKY 502 N+ +N KY S RS RER E I S N Y + Y Sbjct: 47 NSYKNEREYRKYRETSKERSRDRAERERSREPKIISSLSNNTIHNNNYKYNYNNNNY 103 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.4 bits (48), Expect = 1.9 Identities = 16/57 (28%), Positives = 19/57 (33%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSIHKDKSKRKR*NGXL*YTTSXKKY 502 N+ +N KY S RS RER E I S N Y + Y Sbjct: 48 NSYKNEREYRKYRETSKERSRDRTERERSREPKIISSLSNNTIHNNNYKYNYNNNNY 104 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.4 bits (48), Expect = 1.9 Identities = 16/57 (28%), Positives = 19/57 (33%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSIHKDKSKRKR*NGXL*YTTSXKKY 502 N+ +N KY S RS RER E I S N Y + Y Sbjct: 48 NSYKNEREYRKYRETSKERSRDRTERERSREPKIISSLSNNTIHNNNYKYNYNNNNY 104 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.4 bits (48), Expect = 1.9 Identities = 16/57 (28%), Positives = 19/57 (33%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSIHKDKSKRKR*NGXL*YTTSXKKY 502 N+ +N KY S RS RER E I S N Y + Y Sbjct: 48 NSYKNEREYRKYRETSKERSRDRTERERSREPKIISSLSNNTIHNNNYKYNYNNNNY 104 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.4 bits (48), Expect = 1.9 Identities = 16/57 (28%), Positives = 19/57 (33%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSIHKDKSKRKR*NGXL*YTTSXKKY 502 N+ +N KY S RS RER E I S N Y + Y Sbjct: 48 NSYKNEREYRKYRETSKERSRDRTERERSREPKIISSLSNNTIHNNNYKYNYNNNNY 104 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.6 bits (46), Expect = 3.4 Identities = 13/41 (31%), Positives = 16/41 (39%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSIHKDKSKR 454 N+ +N KY S RS RER E I S + Sbjct: 48 NSYKNEKEYRKYRETSKERSRDRTERERSREPKIISSLSNK 88 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.6 bits (46), Expect = 3.4 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSI 433 N+ +N KY S RS RER E+ I Sbjct: 270 NSYKNEREYRKYRETSKGRSRDRTERERSKETKI 303 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 3.4 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSI 433 N+ +N KY S RS RER E+ I Sbjct: 281 NSYKNEREYRKYRETSKGRSRDRTERERSKETKI 314 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +2 Query: 302 PQKTNKRFLVNTIRNAXGSNKYHFKSHRRSHKS 400 P+K NKR L ++ N +++Y R S+ + Sbjct: 432 PKKDNKRKLSDSTMNKINNHEYKRSVSRESNSN 464 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 22.2 bits (45), Expect = 4.5 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSI 433 N+ +N KY S RS RER E I Sbjct: 48 NSYKNEREYRKYRETSKERSRDRTERERSREPKI 81 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 4.5 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSI 433 N+ +N KY S RS RER E I Sbjct: 48 NSYKNEREYRKYRETSKERSRDRRERERSKEPKI 81 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 22.2 bits (45), Expect = 4.5 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSI 433 N+ +N KY S RS RER E I Sbjct: 48 NSYKNEREYRKYRETSKERSRDRRERERSKEPKI 81 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 4.5 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSI 433 N+ +N KY S RS RER E I Sbjct: 48 NSYKNEREYRKYRETSKERSRDRRERERSKEPKI 81 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 4.5 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSI 433 N+ +N KY S RS RER E I Sbjct: 48 NSYKNEREYRKYRETSKERSRDRRERERSKEPKI 81 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 4.5 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSI 433 N+ +N KY S RS RER E I Sbjct: 48 NSYKNEREYRKYRETSKERSRDRRERERSKEPKI 81 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 4.5 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSI 433 N+ +N KY S RS RER E I Sbjct: 48 NSYKNEREYRKYRETSKERSRDRRERERSKEPKI 81 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 4.5 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSI 433 N+ +N KY S RS RER E I Sbjct: 48 NSYKNEREYRKYRETSKERSRDRRERERSKEPKI 81 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 4.5 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSI 433 N+ +N KY S RS RER E I Sbjct: 48 NSYKNEREYRKYRETSKERSRDRRERERSKEPKI 81 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.2 bits (45), Expect = 4.5 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSI 433 N+ +N KY S RS RER E I Sbjct: 270 NSYKNEREYRKYRETSKERSRDRRERERSKEPKI 303 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 5.9 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSI 433 N+ +N KY S RS RER E I Sbjct: 48 NSYKNEREYQKYRETSKERSRDRTERERCKEPKI 81 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 5.9 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSI 433 N+ +N KY S RS RER E I Sbjct: 48 NSYKNEREYQKYRETSKERSRDRTERERCKEPKI 81 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 5.9 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSI 433 N+ +N KY S RS RER E I Sbjct: 48 NSYKNEREYQKYRETSKERSRDRTERERCKEPKI 81 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 5.9 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSI 433 N+ +N KY S RS RER E I Sbjct: 48 NSYKNEREYQKYRETSKERSRDRTERERCKEPKI 81 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 5.9 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSI 433 N+ +N KY S RS RER E I Sbjct: 48 NSYKNEREYQKYRETSKERSRDRTERERCKEPKI 81 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 5.9 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSI 433 N+ +N KY S RS RER E I Sbjct: 48 NSYKNEREYQKYRETSKERSRDRTERERCKEPKI 81 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 5.9 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSI 433 N+ +N KY S RS RER E I Sbjct: 48 NSYKNEREYQKYRETSKERSRDRTERERCKEPKI 81 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 21.8 bits (44), Expect = 5.9 Identities = 15/53 (28%), Positives = 18/53 (33%) Frame = +2 Query: 341 RNAXGSNKYHFKSHRRSHKSPTRERRSESSIHKDKSKRKR*NGXL*YTTSXKK 499 +N KY S RS RER E I S + + Y KK Sbjct: 51 KNENSYRKYRETSKERSRDRKERERSKEPKIISSLSNNYKYSNYNNYNNYNKK 103 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 7.8 Identities = 11/34 (32%), Positives = 14/34 (41%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSI 433 N+ +N KY S RS RE+ E I Sbjct: 48 NSYKNEREYRKYRETSKERSRDRKEREKSKEHKI 81 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 7.8 Identities = 11/34 (32%), Positives = 14/34 (41%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSI 433 N+ +N KY S RS RE+ E I Sbjct: 48 NSYKNEREYRKYRETSKERSRDRKEREKSKEHKI 81 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 7.8 Identities = 11/34 (32%), Positives = 14/34 (41%) Frame = +2 Query: 332 NTIRNAXGSNKYHFKSHRRSHKSPTRERRSESSI 433 N+ +N KY S RS RE+ E I Sbjct: 48 NSYKNEREYRKYRETSKERSRDRKEREKSKEHKI 81 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 7.8 Identities = 12/38 (31%), Positives = 14/38 (36%) Frame = +2 Query: 341 RNAXGSNKYHFKSHRRSHKSPTRERRSESSIHKDKSKR 454 +N KY S RS RER E I S + Sbjct: 51 KNENSYRKYRETSKERSRDRKERERSKEPKIISSLSNK 88 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 7.8 Identities = 12/38 (31%), Positives = 14/38 (36%) Frame = +2 Query: 341 RNAXGSNKYHFKSHRRSHKSPTRERRSESSIHKDKSKR 454 +N KY S RS RER E I S + Sbjct: 51 KNENSYRKYRETSKERSRDRKERERSKEPKIISSLSNK 88 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 21.4 bits (43), Expect = 7.8 Identities = 12/38 (31%), Positives = 14/38 (36%) Frame = +2 Query: 341 RNAXGSNKYHFKSHRRSHKSPTRERRSESSIHKDKSKR 454 +N KY S RS RER E I S + Sbjct: 51 KNENSYRKYRETSKERSRDRKERERSKEPKIISSLSNK 88 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 7.8 Identities = 12/38 (31%), Positives = 14/38 (36%) Frame = +2 Query: 341 RNAXGSNKYHFKSHRRSHKSPTRERRSESSIHKDKSKR 454 +N KY S RS RER E I S + Sbjct: 51 KNENSYRKYRETSKERSRDRKERERSKEPKIISSLSNK 88 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 7.8 Identities = 12/38 (31%), Positives = 15/38 (39%) Frame = +2 Query: 341 RNAXGSNKYHFKSHRRSHKSPTRERRSESSIHKDKSKR 454 +N KY +S RS RER E I S + Sbjct: 51 KNERKYRKYRERSKERSRDRTERERSREPKIISSLSNK 88 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 21.4 bits (43), Expect = 7.8 Identities = 12/38 (31%), Positives = 15/38 (39%) Frame = +2 Query: 341 RNAXGSNKYHFKSHRRSHKSPTRERRSESSIHKDKSKR 454 +N KY +S RS RER E I S + Sbjct: 51 KNERKYRKYRERSKERSRDRTERERSREPKIISSLSNK 88 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.4 bits (43), Expect = 7.8 Identities = 11/31 (35%), Positives = 12/31 (38%) Frame = +2 Query: 341 RNAXGSNKYHFKSHRRSHKSPTRERRSESSI 433 +N KY S RS RER E I Sbjct: 289 KNENSYRKYRETSKERSRDKTERERSKERKI 319 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.4 bits (43), Expect = 7.8 Identities = 12/38 (31%), Positives = 14/38 (36%) Frame = +2 Query: 341 RNAXGSNKYHFKSHRRSHKSPTRERRSESSIHKDKSKR 454 +N KY S RS RER E I S + Sbjct: 284 KNENSYRKYRETSKERSRDRKERERSKEPKIISSLSNK 321 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.4 bits (43), Expect = 7.8 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = +3 Query: 357 PINIILRATAALISLQQERDVLNLLFTKISQKENVK 464 PI + ++ ++ S+ E+DV+N + T+I+ K Sbjct: 855 PITSLPASSTSINSITVEKDVINDVKTQITTNTPAK 890 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 125 TVICIKIMTDKEDVDNKP 178 T+ICI I KE ++ P Sbjct: 671 TIICINIKRQKEKIEWDP 688 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,140 Number of Sequences: 438 Number of extensions: 3310 Number of successful extensions: 71 Number of sequences better than 10.0: 44 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -