BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_E08 (343 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 2.6 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 2.6 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 20 6.1 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 20 6.1 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 20 6.1 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 20 6.1 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 20 6.1 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 20 6.1 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 2.6 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -1 Query: 238 ECLRRLIKCVANPAILFLRGLVGMIAISSHILLFV 134 +CL +L K + L L G AI S IL+FV Sbjct: 143 KCLYKLWKMPSLSEFLSLFGTETCPAIGSAILIFV 177 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 2.6 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -1 Query: 238 ECLRRLIKCVANPAILFLRGLVGMIAISSHILLFV 134 +CL +L K + L L G AI S IL+FV Sbjct: 143 KCLYKLWKMPSLSEFLSLFGTETCPAIGSAILIFV 177 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 20.2 bits (40), Expect = 6.1 Identities = 6/16 (37%), Positives = 12/16 (75%) Frame = -2 Query: 144 FYLYQKSSVNRCIVFF 97 +++Y SV +C++FF Sbjct: 296 YFIYMFVSVWKCLLFF 311 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 20.2 bits (40), Expect = 6.1 Identities = 6/16 (37%), Positives = 12/16 (75%) Frame = -2 Query: 144 FYLYQKSSVNRCIVFF 97 +++Y SV +C++FF Sbjct: 296 YFIYMFVSVWKCLLFF 311 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 20.2 bits (40), Expect = 6.1 Identities = 6/16 (37%), Positives = 12/16 (75%) Frame = -2 Query: 144 FYLYQKSSVNRCIVFF 97 +++Y SV +C++FF Sbjct: 296 YFIYMFVSVWKCLLFF 311 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 20.2 bits (40), Expect = 6.1 Identities = 6/16 (37%), Positives = 12/16 (75%) Frame = -2 Query: 144 FYLYQKSSVNRCIVFF 97 +++Y SV +C++FF Sbjct: 296 YFIYMFVSVWKCLLFF 311 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 20.2 bits (40), Expect = 6.1 Identities = 11/43 (25%), Positives = 17/43 (39%) Frame = -2 Query: 135 YQKSSVNRCIVFFNNNLRRFLDGFSPGHDPWLKLYSAAFDKNQ 7 YQ V + +N + FLD + + YS F + Q Sbjct: 184 YQNEEVTALKIKYNPFAKAFLDAKERPDSIYQREYSPTFTQQQ 226 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 20.2 bits (40), Expect = 6.1 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -3 Query: 254 DSSHLRVSETPH 219 D+SH R+SE P+ Sbjct: 302 DTSHNRISEIPN 313 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 72,437 Number of Sequences: 336 Number of extensions: 1423 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 6664455 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -