BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_E08 (343 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC839.05c |rps1701|rps17-1|40S ribosomal protein S17|Schizosac... 63 1e-11 SPCC24B10.09 |rps1702|rps17-2, rps17|40S ribosomal protein S17|S... 63 1e-11 SPCC1442.06 |||20S proteasome component alpha 2|Schizosaccharomy... 26 1.4 SPAC1B3.09c |||Noc2p-Noc3p complex subunit Noc2 family |Schizosa... 26 1.4 SPBC29A10.04 |psm1|smc1|mitotic cohesin complex subunit Psm1 |Sc... 26 1.8 SPCC1235.04c |||FAD synthetase|Schizosaccharomyces pombe|chr 3||... 25 2.4 SPAC13G6.03 |gpi7||GPI anchor biosynthesis protein Gpi7 |Schizos... 25 3.2 SPAC17G6.12 |cul1|pcu1|cullin 1|Schizosaccharomyces pombe|chr 1|... 25 4.3 SPBC16D10.04c |dna2||DNA replication endonuclease-helicase Dna2|... 24 7.5 SPAC1782.01 ||SPAPYUG7.07|proteasome component|Schizosaccharomyc... 24 7.5 SPBC12C2.12c |glo1|SPBC21D10.03c|glyoxalase I |Schizosaccharomyc... 23 9.8 >SPBC839.05c |rps1701|rps17-1|40S ribosomal protein S17|Schizosaccharomyces pombe|chr 2|||Manual Length = 131 Score = 63.3 bits (147), Expect = 1e-11 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = +3 Query: 123 LTFDTNKRICEEIAIIPTKPLRNKIAGFATHLMRRLRHSQVRGILYQ 263 L F TNKRI +E+AII +K LRNKIAG+ THLM+R++ VRGI ++ Sbjct: 26 LDFQTNKRIVDEVAIIASKRLRNKIAGYTTHLMKRIQRGPVRGISFK 72 Score = 35.1 bits (77), Expect = 0.003 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = +1 Query: 256 SIKLXEXERERRDNYVPXVSALE 324 S KL E ERER+D YVP VS LE Sbjct: 70 SFKLQEEERERKDQYVPEVSELE 92 >SPCC24B10.09 |rps1702|rps17-2, rps17|40S ribosomal protein S17|Schizosaccharomyces pombe|chr 3|||Manual Length = 132 Score = 63.3 bits (147), Expect = 1e-11 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = +3 Query: 123 LTFDTNKRICEEIAIIPTKPLRNKIAGFATHLMRRLRHSQVRGILYQ 263 L F TNKRI +E+AII +K LRNKIAG+ THLM+R++ VRGI ++ Sbjct: 26 LDFQTNKRIVDEVAIIASKRLRNKIAGYTTHLMKRIQRGPVRGISFK 72 Score = 35.1 bits (77), Expect = 0.003 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = +1 Query: 256 SIKLXEXERERRDNYVPXVSALE 324 S KL E ERER+D YVP VS LE Sbjct: 70 SFKLQEEERERKDQYVPEVSELE 92 >SPCC1442.06 |||20S proteasome component alpha 2|Schizosaccharomyces pombe|chr 3|||Manual Length = 245 Score = 26.2 bits (55), Expect = 1.4 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 156 EIAIIPTKPLRNKIAGFATHLMRRLRHSQVRGILYQ 263 EIA++ TKP + I G RL S++R L Q Sbjct: 209 EIAVVSTKPTDSGIVGVPGGHFCRLSQSEIRDYLDQ 244 >SPAC1B3.09c |||Noc2p-Noc3p complex subunit Noc2 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 528 Score = 26.2 bits (55), Expect = 1.4 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 202 PAILFLRGLVGMIAISSHILLFVSKVK 122 P I LRGLV A H+L F++K++ Sbjct: 457 PIIAQLRGLVNESAPGKHVLTFLNKLE 483 >SPBC29A10.04 |psm1|smc1|mitotic cohesin complex subunit Psm1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1233 Score = 25.8 bits (54), Expect = 1.8 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +1 Query: 226 VSDTRKCEESSIKLXEXERERRDNYVPXVSALET 327 VSDTR E K E ++E DNY ALE+ Sbjct: 833 VSDTRLRLERMHKFIEKDQESIDNYEQNREALES 866 >SPCC1235.04c |||FAD synthetase|Schizosaccharomyces pombe|chr 3|||Manual Length = 265 Score = 25.4 bits (53), Expect = 2.4 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -2 Query: 306 WDIVVTPLTLLFXKFDRGFLALASV*DASLN 214 WD+++ T +DRG+ +L V D S N Sbjct: 181 WDLLLETNTKYCSLYDRGYTSLGGVSDTSPN 211 >SPAC13G6.03 |gpi7||GPI anchor biosynthesis protein Gpi7 |Schizosaccharomyces pombe|chr 1|||Manual Length = 758 Score = 25.0 bits (52), Expect = 3.2 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -2 Query: 57 GHDPWLKLYSAAFDK 13 G D WLKL+ +AF K Sbjct: 146 GDDTWLKLFPSAFSK 160 >SPAC17G6.12 |cul1|pcu1|cullin 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 767 Score = 24.6 bits (51), Expect = 4.3 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +1 Query: 226 VSDTRKCEESSIKLXEXERERRDNYV 303 VSD ++C + I+ ER+ RD Y+ Sbjct: 739 VSDIKQCIDMLIEKEYLERQGRDEYI 764 >SPBC16D10.04c |dna2||DNA replication endonuclease-helicase Dna2|Schizosaccharomyces pombe|chr 2|||Manual Length = 1398 Score = 23.8 bits (49), Expect = 7.5 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -2 Query: 54 HDPWLKLYSAAFDKNQ 7 H PWLK+ + F KNQ Sbjct: 841 HIPWLKMPNFDFKKNQ 856 >SPAC1782.01 ||SPAPYUG7.07|proteasome component|Schizosaccharomyces pombe|chr 1|||Manual Length = 1679 Score = 23.8 bits (49), Expect = 7.5 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 171 PTKPLRNKIAGFATHLMRRLRHS 239 P + +RNK A H+M RL ++ Sbjct: 43 PHESVRNKTISIANHIMTRLNNN 65 >SPBC12C2.12c |glo1|SPBC21D10.03c|glyoxalase I |Schizosaccharomyces pombe|chr 2|||Manual Length = 302 Score = 23.4 bits (48), Expect = 9.8 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = +1 Query: 130 LIQIKEYVKKSLSFLPSLLGIKLLD 204 +I++K+ + KSL F + G+KL+D Sbjct: 16 MIRVKD-LDKSLKFYTEVFGMKLID 39 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,275,586 Number of Sequences: 5004 Number of extensions: 22413 Number of successful extensions: 63 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 63 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 100068878 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -